S1PR5 (sphingosine-1-phosphate receptor 5) - Rat Genome Database

S1PR5 (sphingosine-1-phosphate receptor 5) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: S1PR5 (sphingosine-1-phosphate receptor 5) Homo sapiens

Subscribe to Updates

Symbol:

S1PR5

Name:

sphingosine-1-phosphate receptor 5

RGD ID:

733271

HGNC Page

Description:

Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to be located in membrane. Predicted to be active in cytoplasm; plasma membrane; and presynapse.

Type:

protein-coding

RefSeq Status:

Previously known as:

Edg-8; EDG8; endothelial differentiation G-protein-coupled receptor 8; endothelial differentiation, sphingolipid G-protein-coupled receptor, 8; S1P receptor 5; S1P receptor Edg-8; S1P5; sphingosine 1-phosphate receptor 5; sphingosine 1-phosphate receptor Edg-8; sphingosine 1-phosphate receptor EDG8; SPPR-1; SPPR-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,512,742 - 10,517,965 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,512,742 - 10,517,931 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,623,418 - 10,628,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,484,623 - 10,489,112 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,484,622 - 10,489,112	NCBI
Celera	19	10,518,131 - 10,523,388 (-)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,201,961 - 10,207,399 (-)	NCBI		HuRef
CHM1_1	19	10,624,176 - 10,629,433 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,639,179 - 10,644,407 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	COVID-19		HEP		28912744	mRNA:decreased expression:peripheral blood mononuclear cell (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	familial hypercholesterolemia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial hypercholesterolemia	ClinVar	PMID:20809525 more ...
S1PR5	Human	immunodeficiency 35		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 35	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	Experimental Diabetes Mellitus		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22406263
S1PR5	Human	systemic scleroderma		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29033951

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of S1PR5 mRNA	CTD	PMID:36331819
S1PR5	Human	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of S1PR5 mRNA	CTD	PMID:23019147
S1PR5	Human	17beta-estradiol	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Estradiol results in decreased expression of S1PR5 mRNA	CTD	PMID:39298647
S1PR5	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of S1PR5 mRNA	CTD	PMID:23152189
S1PR5	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of S1PR5 mRNA	CTD	PMID:26290441
S1PR5	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	S1pr5 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of S1PR5 mRNA	CTD	PMID:26377647
S1PR5	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of S1PR5 mRNA	CTD	PMID:25975270
S1PR5	Human	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	3 more ...	CTD	PMID:19467301
S1PR5	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	bisphenol S results in decreased expression of S1PR5 mRNA	CTD	PMID:39298647
S1PR5	Human	5-aza-2'-deoxycytidine	affects expression	EXP		6480464	Decitabine affects the expression of S1PR5 mRNA	CTD	PMID:23300844
S1PR5	Human	6-propyl-2-thiouracil	decreases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of S1PR5 mRNA	CTD	PMID:24780913 and PMID:25825206
S1PR5	Human	acetamide	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	acetamide results in increased expression of S1PR5 mRNA	CTD	PMID:31881176
S1PR5	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of S1PR5 promoter	CTD	PMID:30157460
S1PR5	Human	aldehydo-D-glucose	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Glucose results in increased expression of S1PR5 mRNA	CTD	PMID:22406263
S1PR5	Human	ammonium chloride	affects expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of S1PR5 mRNA	CTD	PMID:16483693
S1PR5	Human	arsane	increases methylation	EXP		6480464	Arsenic results in increased methylation of S1PR5 promoter	CTD	PMID:21291286
S1PR5	Human	arsenic atom	increases methylation	EXP		6480464	Arsenic results in increased methylation of S1PR5 promoter	CTD	PMID:21291286
S1PR5	Human	arsenous acid	decreases expression	EXP		6480464	Arsenic Trioxide results in decreased expression of S1PR5 mRNA	CTD	PMID:26705709
S1PR5	Human	benzo[a]pyrene	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of S1PR5 mRNA	CTD	PMID:19770486 more ...
S1PR5	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of S1PR5 5' UTR and Benzo(a)pyrene results in increased methylation of S1PR5 promoter	CTD	PMID:27901495
S1PR5	Human	benzo[b]fluoranthene	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	benzo(b)fluoranthene results in decreased expression of S1PR5 mRNA	CTD	PMID:26377693
S1PR5	Human	Benzo[k]fluoranthene	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	benzo(k)fluoranthene results in decreased expression of S1PR5 mRNA	CTD	PMID:26377693
S1PR5	Human	bis(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	Diethylhexyl Phthalate results in decreased expression of S1PR5 mRNA	CTD	PMID:31163220
S1PR5	Human	bisphenol A	decreases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of S1PR5 mRNA	CTD	PMID:25181051 more ...
S1PR5	Human	bisphenol A	increases expression	ISO	S1pr5 (Mus musculus)	6480464	bisphenol A results in increased expression of S1PR5 mRNA	CTD	PMID:32156529
S1PR5	Human	bisphenol A	increases methylation	ISO	S1pr5 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of S1PR5 gene	CTD	PMID:28505145
S1PR5	Human	bleomycin A2	affects response to substance	ISO	S1pr5 (Mus musculus)	6480464	S1PR5 protein affects the susceptibility to Bleomycin	CTD	PMID:29033951
S1PR5	Human	bleomycin A2	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	[S1PR5 protein affects the susceptibility to Bleomycin] which affects the expression of COMP protein more ...	CTD	PMID:29033951
S1PR5	Human	cannabidiol	decreases expression	EXP		6480464	Cannabidiol results in decreased expression of S1PR5 mRNA	CTD	PMID:33244087
S1PR5	Human	carbon nanotube	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
S1PR5	Human	carbon nanotube	increases expression	ISO	S1pr5 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25620056
S1PR5	Human	chloroprene	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Chloroprene results in decreased expression of S1PR5 mRNA	CTD	PMID:23125180
S1PR5	Human	cisplatin	affects expression	EXP		6480464	Cisplatin affects the expression of S1PR5 mRNA	CTD	PMID:23300844
S1PR5	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of S1PR5 mRNA	CTD	PMID:27392435
S1PR5	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of S1PR5 mRNA	CTD	PMID:27392435
S1PR5	Human	copper atom	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of S1PR5 mRNA	CTD	PMID:26033743
S1PR5	Human	copper(0)	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of S1PR5 mRNA	CTD	PMID:26033743
S1PR5	Human	Cuprizon	decreases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Cuprizone results in decreased expression of S1PR5 mRNA	CTD	PMID:26577399 and PMID:27523638
S1PR5	Human	D-glucose	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Glucose results in increased expression of S1PR5 mRNA	CTD	PMID:22406263
S1PR5	Human	diallyl disulfide	multiple interactions	EXP		6480464	diallyl disulfide inhibits the reaction [tobacco tar analog results in decreased expression of S1PR5 mRNA]	CTD	PMID:36758788
S1PR5	Human	Diallyl sulfide	multiple interactions	EXP		6480464	allyl sulfide inhibits the reaction [tobacco tar analog results in decreased expression of S1PR5 mRNA]	CTD	PMID:36758788
S1PR5	Human	diarsenic trioxide	decreases expression	EXP		6480464	Arsenic Trioxide results in decreased expression of S1PR5 mRNA	CTD	PMID:26705709
S1PR5	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of S1PR5 mRNA	CTD	PMID:37042841
S1PR5	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
S1PR5	Human	entinostat	increases expression	EXP		6480464	entinostat results in increased expression of S1PR5 mRNA	CTD	PMID:26272509 and PMID:27188386
S1PR5	Human	entinostat	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S1PR5 mRNA	CTD	PMID:27188386
S1PR5	Human	ethanol	increases expression	ISO	S1pr5 (Mus musculus)	6480464	Ethanol results in increased expression of S1PR5 mRNA	CTD	PMID:19167417
S1PR5	Human	fenvalerate	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	fenvalerate results in increased expression of S1PR5 mRNA	CTD	PMID:30307764
S1PR5	Human	formaldehyde	decreases expression	EXP		6480464	Formaldehyde results in decreased expression of S1PR5 mRNA	CTD	PMID:20655997
S1PR5	Human	genistein	affects expression	ISO	S1pr5 (Mus musculus)	6480464	Genistein affects the expression of S1PR5 mRNA	CTD	PMID:32186404
S1PR5	Human	gentamycin	affects expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Gentamicins affects the expression of S1PR5 mRNA	CTD	PMID:33387578
S1PR5	Human	glucose	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Glucose results in increased expression of S1PR5 mRNA	CTD	PMID:22406263
S1PR5	Human	glycidol	decreases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	glycidol results in decreased expression of S1PR5 mRNA	CTD	PMID:24395379
S1PR5	Human	hydrogen peroxide	affects expression	EXP		6480464	Hydrogen Peroxide affects the expression of S1PR5 mRNA	CTD	PMID:20044591
S1PR5	Human	inulin	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of S1PR5 mRNA	CTD	PMID:36331819
S1PR5	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of S1PR5 mRNA	CTD	PMID:35811015
S1PR5	Human	methylmercury chloride	affects expression	ISO	S1pr5 (Rattus norvegicus)	6480464	methylmercuric chloride affects the expression of S1PR5 mRNA	CTD	PMID:20864626
S1PR5	Human	N-methyl-4-phenylpyridinium	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of S1PR5 mRNA	CTD	PMID:28801915
S1PR5	Human	nitrates	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Nitrates results in increased expression of S1PR5 mRNA	CTD	PMID:30022042
S1PR5	Human	ozone	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Ozone results in decreased expression of S1PR5 mRNA	CTD	PMID:33026818
S1PR5	Human	panobinostat	multiple interactions	EXP		6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S1PR5 mRNA	CTD	PMID:27188386
S1PR5	Human	panobinostat	increases expression	EXP		6480464	panobinostat results in increased expression of S1PR5 mRNA	CTD	PMID:26272509
S1PR5	Human	paracetamol	affects expression	ISO	S1pr5 (Mus musculus)	6480464	Acetaminophen affects the expression of S1PR5 mRNA	CTD	PMID:17562736
S1PR5	Human	parathion	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Parathion results in decreased expression of S1PR5 mRNA	CTD	PMID:34813904
S1PR5	Human	perfluorooctane-1-sulfonic acid	affects expression	ISO	S1pr5 (Rattus norvegicus)	6480464	perfluorooctane sulfonic acid affects the expression of S1PR5 mRNA	CTD	PMID:20136073
S1PR5	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of S1PR5 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of S1PR5 mRNA	CTD	PMID:36331819
S1PR5	Human	phenobarbital	multiple interactions	ISO	S1pr5 (Mus musculus)	6480464	NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of S1PR5 mRNA]	CTD	PMID:19482888
S1PR5	Human	phenobarbital	affects expression	ISO	S1pr5 (Mus musculus)	6480464	Phenobarbital affects the expression of S1PR5 mRNA	CTD	PMID:23091169
S1PR5	Human	phenobarbital	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Phenobarbital results in decreased expression of S1PR5 mRNA	CTD	PMID:19482888
S1PR5	Human	pirinixic acid	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	pirinixic acid results in decreased expression of S1PR5 mRNA	CTD	PMID:23811191
S1PR5	Human	rotenone	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	Rotenone results in decreased expression of S1PR5 mRNA	CTD	PMID:35919817
S1PR5	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of S1PR5 mRNA	CTD	PMID:35811015
S1PR5	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
S1PR5	Human	silicon dioxide	increases expression	ISO	S1pr5 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of S1PR5 mRNA	CTD	PMID:29341224
S1PR5	Human	sodium arsenite	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	sodium arsenite results in decreased expression of S1PR5 mRNA	CTD	PMID:37682722
S1PR5	Human	sphingosine 1-phosphate	multiple interactions	EXP		6480464	Endocannabinoids inhibits the reaction [sphingosine 1-phosphate binds to and results in increased activity of S1PR5 protein] and sphingosine 1-phosphate binds to and results in increased activity of S1PR5 protein	CTD	PMID:30102254
S1PR5	Human	streptozocin	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Streptozocin results in increased expression of S1PR5 mRNA	CTD	PMID:22406263
S1PR5	Human	sulforaphane	decreases expression	ISO	S1pr5 (Mus musculus)	6480464	sulforaphane results in decreased expression of S1PR5 mRNA	CTD	PMID:30529165
S1PR5	Human	thioacetamide	increases expression	ISO	S1pr5 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of S1PR5 mRNA	CTD	PMID:34492290
S1PR5	Human	titanium dioxide	decreases methylation	ISO	S1pr5 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of S1PR5 gene	CTD	PMID:35295148
S1PR5	Human	trichostatin A	increases expression	EXP		6480464	trichostatin A results in increased expression of S1PR5 mRNA	CTD	PMID:24935251
S1PR5	Human	triclosan	decreases expression	EXP		6480464	Triclosan results in decreased expression of S1PR5 mRNA	CTD	PMID:30510588
S1PR5	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of S1PR5 mRNA	CTD	PMID:37042841
S1PR5	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of S1PR5 mRNA	CTD	PMID:25979313
S1PR5	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of S1PR5 mRNA	CTD	PMID:23179753 more ...
S1PR5	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S1PR5 mRNA	CTD	PMID:27188386
S1PR5	Human	vorinostat	increases expression	EXP		6480464	vorinostat results in increased expression of S1PR5 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IBA	MGI:1333809 more ...	150520179		GO_Central	GO_REF:0000033
S1PR5	Human	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	150520179		UniProt	GO_REF:0000043
S1PR5	Human	G protein-coupled receptor signaling pathway	involved_in	IEA	ARBA:ARBA00029021	150520179		UniProt	GO_REF:0000117
S1PR5	Human	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 more ...	150520179		InterPro	GO_REF:0000002
S1PR5	Human	regulation of metabolic process	involved_in	IBA	MGI:101908 more ...	150520179		GO_Central	GO_REF:0000033
S1PR5	Human	regulation of neuron differentiation		ISO	S1pr5 (Rattus norvegicus)	9068941		RGD	PMID:12617946 and REF_RGD_ID:1299278
S1PR5	Human	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	150520179		UniProt	GO_REF:0000043
S1PR5	Human	sphingosine-1-phosphate receptor signaling pathway	involved_in	IEA	GO:0038036	150520179		GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	cytoplasm	is_active_in	IBA	MGI:104615 more ...	150520179		GO_Central	GO_REF:0000033
S1PR5	Human	membrane	located_in	IEA	InterPro:IPR000276 more ...	150520179		InterPro	GO_REF:0000002
S1PR5	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
S1PR5	Human	plasma membrane	is_active_in	IBA	MGI:104615 more ...	150520179		GO_Central	GO_REF:0000033
S1PR5	Human	plasma membrane	located_in	TAS		150520179		Reactome	Reactome:R-HSA-380073 more ...
S1PR5	Human	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043
S1PR5	Human	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
S1PR5	Human	presynapse	is_active_in	IEA	UniProtKB:Q91X56 and ensembl:ENSMUSP00000113843	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	G protein-coupled receptor activity		ISO	S1pr5 (Rattus norvegicus)	9068941		RGD	PMID:10799507 and REF_RGD_ID:632648
S1PR5	Human	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	150520179		InterPro	GO_REF:0000002
S1PR5	Human	G protein-coupled receptor activity	enables	IBA	MGI:104615 more ...	150520179		GO_Central	GO_REF:0000033
S1PR5	Human	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	150520179		UniProt	GO_REF:0000043
S1PR5	Human	protein binding	enables	IPI	UniProtKB:P48165 and UniProtKB:Q8WWF3	150520179	PMID:32296183	IntAct	PMID:32296183
S1PR5	Human	sphingosine-1-phosphate receptor activity	enables	IEA	InterPro:IPR004061 and InterPro:IPR005386	150520179		InterPro	GO_REF:0000002

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
S1PR5	Human	sphingosine 1-phosphate signaling pathway		EXP		6484113		PID	PID:200076
S1PR5	Human	sphingosine 1-phosphate signaling pathway		EXP		6484113		PID	PID:200054
S1PR5	Human	sphingosine 1-phosphate signaling pathway		EXP		6484113		PID	PID:200123

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Characterization of a novel sphingosine 1-phosphate receptor, Edg-8.	Im DS, etal., J Biol Chem 2000 May 12;275(19):14281-6.
3.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Transcriptomic characteristics of bronchoalveolar lavage fluid and peripheral blood mononuclear cells in COVID-19 patients.	Xiong Y, etal., Emerg Microbes Infect. 2020 Dec;9(1):761-770. doi: 10.1080/22221751.2020.1747363.

PMID:2834384	PMID:11069896	PMID:11705398	PMID:12044878	PMID:12234605	PMID:12427546	PMID:12477932	PMID:12648236	PMID:14702039	PMID:15057824	PMID:15489334	PMID:15530552
PMID:16303743	PMID:16344560	PMID:17918267	PMID:18577758	PMID:19211033	PMID:19474291	PMID:20085233	PMID:20950786	PMID:21873635	PMID:22541110	PMID:22715976	PMID:23551178
PMID:24602016	PMID:24903384	PMID:25601519	PMID:26186194	PMID:27868302	PMID:28298427	PMID:28351953	PMID:28514442	PMID:29248494	PMID:32296183	PMID:32322062	PMID:32393512
PMID:32513696	PMID:33845483	PMID:33961781	PMID:34271437

S1PR5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,512,742 - 10,517,965 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,512,742 - 10,517,931 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,623,418 - 10,628,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,484,623 - 10,489,112 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,484,622 - 10,489,112	NCBI
Celera	19	10,518,131 - 10,523,388 (-)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,201,961 - 10,207,399 (-)	NCBI		HuRef
CHM1_1	19	10,624,176 - 10,629,433 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,639,179 - 10,644,407 (-)	NCBI		T2T-CHM13v2.0

S1pr5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,154,213 - 21,159,739 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,154,208 - 21,159,739 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,242,917 - 21,248,443 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,242,912 - 21,248,443 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	21,047,361 - 21,052,887 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	20,993,319 - 20,996,611 (-)	NCBI		MGSCv36	mm8
Celera	9	18,512,032 - 18,517,558 (-)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.75	NCBI

S1pr5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	28,062,841 - 28,068,013 (-)	NCBI		GRCr8
mRatBN7.2	8	19,786,676 - 19,791,862 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,786,663 - 19,791,795 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,806,109 - 23,811,040 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,103,954 - 22,108,885 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,016,404 - 20,021,375 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,268,635 - 22,273,708 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,268,657 - 22,270,647 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,323,891 - 22,328,932 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,278,404 - 20,283,375 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	20,278,403 - 20,283,375 (-)	NCBI
Celera	8	21,180,228 - 21,185,199 (-)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

S1pr5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955495	1,717,549 - 1,722,257 (-)	NCBI	ChiLan1.0	ChiLan1.0

S1PR5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	15,430,929 - 15,436,593 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	14,429,534 - 14,435,210 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	10,064,332 - 10,069,999 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	10,726,661 - 10,731,230 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	10,727,527 - 10,728,728 (-)	Ensembl	panpan1.1		panPan2

S1PR5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,641,585 - 50,646,938 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,643,619 - 50,644,815 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,513,495 - 50,518,968 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	51,164,592 - 51,170,064 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	51,165,296 - 51,168,809 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,371,184 - 50,376,633 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,799,276 - 50,804,758 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	51,040,334 - 51,045,813 (+)	NCBI		UU_Cfam_GSD_1.0

S1pr5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,551,873 - 209,557,153 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	798,707 - 799,903 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	798,259 - 801,563 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

S1PR5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,293,546 - 69,298,377 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,293,537 - 69,299,408 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	69,646,773 - 69,649,084 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

S1PR5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,537,083 - 9,542,610 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	9,538,156 - 9,539,352 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	10,456,440 - 10,461,715 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

S1pr5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,592,475 - 2,601,943 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,590,664 - 2,602,136 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in S1PR5
43 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 19p13.2-13.13(chr19:8831147-13331227)x3	copy number gain	See cases [RCV000052908]	Chr19:8831147..13331227 [GRCh38] Chr19:8941823..13442041 [GRCh37] Chr19:8802823..13303041 [NCBI36] Chr19:19p13.2-13.13	likely pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:10315258-14048994)x3	copy number gain	See cases [RCV000052909]	Chr19:10315258..14048994 [GRCh38] Chr19:10425934..14159806 [GRCh37] Chr19:10286934..14020806 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.2(chr19:9735443-11228001)x1	copy number loss	See cases [RCV000135403]	Chr19:9735443..11228001 [GRCh38] Chr19:9846119..11338677 [GRCh37] Chr19:9707119..11199677 [NCBI36] Chr19:19p13.2	pathogenic
GRCh38/hg38 19p13.2(chr19:10156406-10889688)x3	copy number gain	See cases [RCV000136738]	Chr19:10156406..10889688 [GRCh38] Chr19:10267082..11000364 [GRCh37] Chr19:10128082..10861364 [NCBI36] Chr19:19p13.2	pathogenic
GRCh38/hg38 19p13.2(chr19:10330655-10920552)x1	copy number loss	See cases [RCV000141708]	Chr19:10330655..10920552 [GRCh38] Chr19:10441331..11031228 [GRCh37] Chr19:10302331..10892228 [NCBI36] Chr19:19p13.2	likely pathogenic
GRCh38/hg38 19p13.2-13.13(chr19:10319474-13777860)x1	copy number loss	See cases [RCV000141568]	Chr19:10319474..13777860 [GRCh38] Chr19:10430150..13888674 [GRCh37] Chr19:10291150..13749674 [NCBI36] Chr19:19p13.2-13.13	pathogenic
GRCh37/hg19 19p13.2(chr19:10584393-10938252)x3	copy number gain	See cases [RCV000449205]	Chr19:10584393..10938252 [GRCh37] Chr19:19p13.2	uncertain significance
GRCh37/hg19 19p13.2-13.12(chr19:9678768-14853426)	copy number gain	See cases [RCV000446985]	Chr19:9678768..14853426 [GRCh37] Chr19:19p13.2-13.12	pathogenic
GRCh37/hg19 19p13.2(chr19:10286133-11040457)x1	copy number loss	See cases [RCV000446752]	Chr19:10286133..11040457 [GRCh37] Chr19:19p13.2	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)x3	copy number gain	See cases [RCV000511289]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic\|uncertain significance
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)	copy number gain	See cases [RCV000512296]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-59097160)x3	copy number gain	not provided [RCV000752444]	Chr19:260912..59097160 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:68029-59110290)x3	copy number gain	not provided [RCV000752439]	Chr19:68029..59110290 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
NM_030760.5(S1PR5):c.429G>A (p.Ala143=)	single nucleotide variant	not provided [RCV000925195]	Chr19:10514583 [GRCh38] Chr19:10625259 [GRCh37] Chr19:19p13.2	likely benign
NM_030760.5(S1PR5):c.1178C>G (p.Ser393Ter)	single nucleotide variant	not provided [RCV000970352]	Chr19:10513834 [GRCh38] Chr19:10624510 [GRCh37] Chr19:19p13.2	likely benign
NM_030760.5(S1PR5):c.567C>T (p.Tyr189=)	single nucleotide variant	not provided [RCV000949050]	Chr19:10514445 [GRCh38] Chr19:10625121 [GRCh37] Chr19:19p13.2	benign
NM_030760.5(S1PR5):c.923T>A (p.Leu308His)	single nucleotide variant	not provided [RCV000970353]	Chr19:10514089 [GRCh38] Chr19:10624765 [GRCh37] Chr19:19p13.2	benign
GRCh37/hg19 19p13.2(chr19:10441330-10977962)x1	copy number loss	not provided [RCV000849141]	Chr19:10441330..10977962 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.825G>A (p.Val275=)	single nucleotide variant	not provided [RCV000962689]	Chr19:10514187 [GRCh38] Chr19:10624863 [GRCh37] Chr19:19p13.2	benign
NM_030760.5(S1PR5):c.423G>A (p.Gly141=)	single nucleotide variant	not provided [RCV000971434]	Chr19:10514589 [GRCh38] Chr19:10625265 [GRCh37] Chr19:19p13.2	benign\|likely benign
GRCh37/hg19 19p13.2(chr19:10584393-10938252)	copy number gain	not specified [RCV002052674]	Chr19:10584393..10938252 [GRCh37] Chr19:19p13.2	uncertain significance
GRCh37/hg19 19p13.2(chr19:9941033-11739567)x3	copy number gain	not provided [RCV001834267]	Chr19:9941033..11739567 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.902T>C (p.Leu301Pro)	single nucleotide variant	not specified [RCV004156251]	Chr19:10514110 [GRCh38] Chr19:10624786 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.449G>T (p.Arg150Leu)	single nucleotide variant	not specified [RCV004107613]	Chr19:10514563 [GRCh38] Chr19:10625239 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.67G>A (p.Gly23Ser)	single nucleotide variant	not specified [RCV004230442]	Chr19:10514945 [GRCh38] Chr19:10625621 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.995C>T (p.Pro332Leu)	single nucleotide variant	not specified [RCV004096029]	Chr19:10514017 [GRCh38] Chr19:10624693 [GRCh37] Chr19:19p13.2	likely benign
NM_030760.5(S1PR5):c.703A>G (p.Thr235Ala)	single nucleotide variant	not specified [RCV004117678]	Chr19:10514309 [GRCh38] Chr19:10624985 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.631C>G (p.Leu211Val)	single nucleotide variant	not specified [RCV004163022]	Chr19:10514381 [GRCh38] Chr19:10625057 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.427G>A (p.Ala143Thr)	single nucleotide variant	not specified [RCV004238483]	Chr19:10514585 [GRCh38] Chr19:10625261 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.278T>C (p.Ile93Thr)	single nucleotide variant	not specified [RCV004108505]	Chr19:10514734 [GRCh38] Chr19:10625410 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.644T>G (p.Ile215Ser)	single nucleotide variant	not specified [RCV004180611]	Chr19:10514368 [GRCh38] Chr19:10625044 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.139T>G (p.Cys47Gly)	single nucleotide variant	not specified [RCV004154605]	Chr19:10514873 [GRCh38] Chr19:10625549 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.820G>T (p.Asp274Tyr)	single nucleotide variant	not specified [RCV004096765]	Chr19:10514192 [GRCh38] Chr19:10624868 [GRCh37] Chr19:19p13.2	uncertain significance
GRCh37/hg19 19p13.2(chr19:10624491-10969019)x3	copy number gain	not provided [RCV003223007]	Chr19:10624491..10969019 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.686G>A (p.Arg229Gln)	single nucleotide variant	not specified [RCV004278377]	Chr19:10514326 [GRCh38] Chr19:10625002 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.1073G>A (p.Gly358Glu)	single nucleotide variant	not specified [RCV004355614]	Chr19:10513939 [GRCh38] Chr19:10624615 [GRCh37] Chr19:19p13.2	uncertain significance
GRCh37/hg19 19p13.2(chr19:10477778-11154144)x3	copy number gain	not provided [RCV003485192]	Chr19:10477778..11154144 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.984C>T (p.Cys328=)	single nucleotide variant	not provided [RCV003421826]	Chr19:10514028 [GRCh38] Chr19:10624704 [GRCh37] Chr19:19p13.2	likely benign
GRCh37/hg19 19p13.2(chr19:10441330-13077352)x1	copy number loss	not specified [RCV003986120]	Chr19:10441330..13077352 [GRCh37] Chr19:19p13.2	pathogenic
NM_030760.5(S1PR5):c.536T>C (p.Leu179Pro)	single nucleotide variant	not specified [RCV004447286]	Chr19:10514476 [GRCh38] Chr19:10625152 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.598G>C (p.Ala200Pro)	single nucleotide variant	not specified [RCV004447287]	Chr19:10514414 [GRCh38] Chr19:10625090 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.683C>T (p.Ala228Val)	single nucleotide variant	not specified [RCV004447288]	Chr19:10514329 [GRCh38] Chr19:10625005 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.68G>T (p.Gly23Val)	single nucleotide variant	not specified [RCV004447289]	Chr19:10514944 [GRCh38] Chr19:10625620 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.212T>C (p.Met71Thr)	single nucleotide variant	not specified [RCV004447283]	Chr19:10514800 [GRCh38] Chr19:10625476 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.29C>G (p.Pro10Arg)	single nucleotide variant	not specified [RCV004447284]	Chr19:10514983 [GRCh38] Chr19:10625659 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.830G>T (p.Cys277Phe)	single nucleotide variant	not specified [RCV004447290]	Chr19:10514182 [GRCh38] Chr19:10624858 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.1180G>A (p.Glu394Lys)	single nucleotide variant	not specified [RCV004447281]	Chr19:10513832 [GRCh38] Chr19:10624508 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.385A>G (p.Ile129Val)	single nucleotide variant	not specified [RCV004447285]	Chr19:10514627 [GRCh38] Chr19:10625303 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.124G>T (p.Val42Leu)	single nucleotide variant	not specified [RCV004447282]	Chr19:10514888 [GRCh38] Chr19:10625564 [GRCh37] Chr19:19p13.2	uncertain significance
NC_000019.9:g.(?_10244343)_(11231218_?)del	deletion	Familial hypercholesterolemia [RCV004581010]	Chr19:10244343..11231218 [GRCh37] Chr19:19p13.2	pathogenic
NM_030760.5(S1PR5):c.508G>T (p.Ala170Ser)	single nucleotide variant	not specified [RCV004661317]	Chr19:10514504 [GRCh38] Chr19:10625180 [GRCh37] Chr19:19p13.2	uncertain significance
NC_000019.9:g.(?_10461510)_(10941723_?)dup	duplication	Immunodeficiency 35 [RCV004581092]	Chr19:10461510..10941723 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.113C>A (p.Ala38Asp)	single nucleotide variant	not specified [RCV004674427]	Chr19:10514899 [GRCh38] Chr19:10625575 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.1107G>C (p.Gln369His)	single nucleotide variant	not specified [RCV004661316]	Chr19:10513905 [GRCh38] Chr19:10624581 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.218T>C (p.Leu73Pro)	single nucleotide variant	not specified [RCV004661314]	Chr19:10514794 [GRCh38] Chr19:10625470 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.367G>A (p.Val123Met)	single nucleotide variant	not specified [RCV004863563]	Chr19:10514645 [GRCh38] Chr19:10625321 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.1153C>A (p.Pro385Thr)	single nucleotide variant	not specified [RCV004863564]	Chr19:10513859 [GRCh38] Chr19:10624535 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.440G>C (p.Ser147Thr)	single nucleotide variant	not specified [RCV004863565]	Chr19:10514572 [GRCh38] Chr19:10625248 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.713C>G (p.Thr238Ser)	single nucleotide variant	not specified [RCV004863566]	Chr19:10514299 [GRCh38] Chr19:10624975 [GRCh37] Chr19:19p13.2	likely benign
NM_030760.5(S1PR5):c.773T>C (p.Leu258Pro)	single nucleotide variant	not specified [RCV004863567]	Chr19:10514239 [GRCh38] Chr19:10624915 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.211A>G (p.Met71Val)	single nucleotide variant	not specified [RCV004863568]	Chr19:10514801 [GRCh38] Chr19:10625477 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.415C>G (p.Arg139Gly)	single nucleotide variant	not specified [RCV004863570]	Chr19:10514597 [GRCh38] Chr19:10625273 [GRCh37] Chr19:19p13.2	uncertain significance
NM_030760.5(S1PR5):c.462G>A (p.Met154Ile)	single nucleotide variant	not specified [RCV004863571]	Chr19:10514550 [GRCh38] Chr19:10625226 [GRCh37] Chr19:19p13.2	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	1000
Count of miRNA genes:	553
Interacting mature miRNAs:	609
Transcripts:	ENST00000333430, ENST00000439028, ENST00000590601
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298499	UAE1_H	Urinary albumin excretion QTL 1 (human)	2.73	0.0009	Urinary albumin excretion	urine albumin:creatinine ratio (ACR)	19	1	16075902	Human
597208233	GWAS1304307_H	mitochondrial DNA measurement QTL GWAS1304307 (human)		0.0000002	mitochondrial DNA measurement		19	10515120	10515121	Human
597417866	GWAS1513940_H	lymphocyte count QTL GWAS1513940 (human)		3e-08	lymphocyte count	blood lymphocyte count (CMO:0000031)	19	10517365	10517366	Human
1643451	SLIPL6_H	Serum lipid level QTL 6 (human)	2.19	0.0008	Lipid level		19	1	16075902	Human
1581534	BP76_H	Blood pressure QTL 76 (human)	2	0.001	Blood pressure	pulse pressure	19	1	16075902	Human
1581535	BP65_H	Blood pressure QTL 65 (human)	3.1	0.001	Blood pressure	pulse pressure	19	1	16075902	Human
2314591	INSUL4_H	Insulin level QTL 4 (human)	3.8	0.000038	Insulin level	fasting	19	1	16075902	Human
597273879	GWAS1369953_H	ICAM-1 measurement QTL GWAS1369953 (human)		1e-15	ICAM-1 measurement		19	10513165	10513166	Human
597273655	GWAS1369729_H	ICAM-1 measurement QTL GWAS1369729 (human)		5e-20	ICAM-1 measurement		19	10517923	10517924	Human
1298476	BP3_H	Blood pressure QTL 3 (human)	2.4		Blood pressure	systolic	19	1	16075902	Human

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	10,623,873 - 10,624,013	UniSTS	GRCh37
Build 36	19	10,484,873 - 10,485,013	RGD	NCBI36
Celera	19	10,518,592 - 10,518,732	RGD
Cytogenetic Map	19	p13.2	UniSTS
HuRef	19	10,202,423 - 10,202,563	UniSTS
TNG Radiation Hybrid Map	19	3414.0	UniSTS

RH78976

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	10,623,778 - 10,623,964	UniSTS	GRCh37
Build 36	19	10,484,778 - 10,484,964	RGD	NCBI36
Celera	19	10,518,497 - 10,518,683	RGD
Cytogenetic Map	19	p13.2	UniSTS
GeneMap99-GB4 RH Map	19	67.7	UniSTS
NCBI RH Map	19	87.9	UniSTS

Edg8

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	10,625,110 - 10,625,661	UniSTS	GRCh37
Celera	19	10,519,829 - 10,520,380	UniSTS
HuRef	19	10,203,660 - 10,204,211	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2274	2713	2207	4949	1720	2328	6	622	1543	464	2264	6752	6015	48	3682	1	835	1730	1594	174	1


RefSeq Transcripts	NM_001166215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_030760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB083602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC011461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF088014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF317676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF331840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF331841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF331842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK074661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK094880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY262689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC034703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC067781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CQ782630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA747912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA866378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB013424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000333430 ⟹ ENSP00000328472

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	10,512,742 - 10,517,447 (-)	Ensembl

Ensembl Acc Id:

ENST00000439028 ⟹ ENSP00000416915

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	10,512,947 - 10,517,931 (-)	Ensembl

Ensembl Acc Id:

ENST00000590601 ⟹ ENSP00000464884

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	10,514,852 - 10,517,427 (-)	Ensembl

Ensembl Acc Id:

ENST00000617721 ⟹ ENSP00000481239

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	10,512,892 - 10,515,021 (-)	Ensembl

RefSeq Acc Id:

NM_001166215 ⟹ NP_001159687

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	10,512,742 - 10,517,965 (-)	NCBI
GRCh37	19	10,623,418 - 10,628,668 (-)	ENTREZGENE
HuRef	19	10,201,961 - 10,207,399 (-)	ENTREZGENE
CHM1_1	19	10,624,176 - 10,629,433 (-)	NCBI
T2T-CHM13v2.0	19	10,639,179 - 10,644,407 (-)	NCBI

Sequence:

show sequence

AGCGGGAACCTATCTGCTGGTGGGAGAGGACTCAGGCTAAGGTGGCCCCCACTGAAGACTCCTGCTAAGCAACCCACTGAAGACCCCTCCGAATCATCGACGGGGCGTCCTTGGGGTGCAGCCCAGGA
AGCTCAGTTCACAGCCTTGGGGCGCGCGGCCCATGGAGTCGGGGCTGCTGCGGCCGGCGCCGGTGAGCGAGGTCATCGTCCTGCATTACAACTACACCGGCAAGCTCCGCGGTGCGCGCTACCAGCCG
GGTGCCGGCCTGCGCGCCGACGCCGTGGTGTGCCTGGCGGTGTGCGCCTTCATCGTGCTAGAGAATCTAGCCGTGTTGTTGGTGCTCGGACGCCACCCGCGCTTCCACGCTCCCATGTTCCTGCTCCT
GGGCAGCCTCACGTTGTCGGATCTGCTGGCAGGCGCCGCCTACGCCGCCAACATCCTACTGTCGGGGCCGCTCACGCTGAAACTGTCCCCCGCGCTCTGGTTCGCACGGGAGGGAGGCGTCTTCGTGG
CACTCACTGCGTCCGTGCTGAGCCTCCTGGCCATCGCGCTGGAGCGCAGCCTCACCATGGCGCGCAGGGGGCCCGCGCCCGTCTCCAGTCGGGGGCGCACGCTGGCGATGGCAGCCGCGGCCTGGGGC
GTGTCGCTGCTCCTCGGGCTCCTGCCAGCGCTGGGCTGGAATTGCCTGGGTCGCCTGGACGCTTGCTCCACTGTCTTGCCGCTCTACGCCAAGGCCTACGTGCTCTTCTGCGTGCTCGCCTTCGTGGG
CATCCTGGCCGCTATCTGTGCACTCTACGCGCGCATCTACTGCCAGGTACGCGCCAACGCGCGGCGCCTGCCGGCACGGCCCGGGACTGCGGGGACCACCTCGACCCGGGCGCGTCGCAAGCCGCGCT
CGCTGGCCTTGCTGCGCACGCTCAGCGTGGTGCTCCTGGCCTTTGTGGCATGTTGGGGCCCCCTCTTCCTGCTGCTGTTGCTCGACGTGGCGTGCCCGGCGCGCACCTGTCCTGTACTCCTGCAGGCC
GATCCCTTCCTGGGACTGGCCATGGCCAACTCACTTCTGAACCCCATCATCTACACGCTCACCAACCGCGACCTGCGCCACGCGCTCCTGCGCCTGGTCTGCTGCGGACGCCACTCCTGCGGCAGAGA
CCCGAGTGGCTCCCAGCAGTCGGCGAGCGCGGCTGAGGCTTCCGGGGGCCTGCGCCGCTGCCTGCCCCCGGGCCTTGATGGGAGCTTCAGCGGCTCGGAGCGCTCATCGCCCCAGCGCGACGGGCTGG
ACACCAGCGGCTCCACAGGCAGCCCCGGTGCACCCACAGCCGCCCGGACTCTGGTATCAGAACCGGCTGCAGACTGACACCCTCGGCCCACGACTGTCTTCCCAAGTTTTACAGACTTGTTCTTTTTA
CATAAAGGAATTTGTAGGAAATGCAGCCAAAGGTGCAGTCGGAAAAGATGCAGGGGAAATGTATTTATGCAGCGACACCCCACAATGTGAACAAACAGACAAAAAATCTGTGCCCTCGTGGAATTGAC
GTTCTGCTTGGGAACACAGAAAAGAACTCGGTGATGAAATAATGGAGATGATTCCAGTGACAAACGACAGAGATGGTGATGGTGGTCAGGGAAGACCTCTCTGCAGAGGTAGTGACTTGTGATGTGAG
CTGAGACCTCTGTCCTGGGAAGACCAAAAGAAAAGCATTTCAGGATGAGGGAATGGCATGCGCAAAGGCCCTGAGGCTGAAATGTGCCCATGTGTTCTAAGAAATGCAGCGATGCTGGTGTGCCTGGA
GCAGGGACGGAGGGGGAGAATGGGAGGAGACAAGGAGCTGAAGGAGTAGTTCCCGAAGGACCTTGTGGGTGATATAGAGGACTTCGCTTTTGCTCTGAGTGAGGTGGGAGCCATAGAAGCTTCTAAGC
AGAAGAGGGACTTGCCCTAATTCAGGTGATCACAGGTGTCTTGTGGCCTCCATGGGAGGTTGAAAACCAGAGAAGGTGAAGGGGGGCTGCACTGAGCCACAGGAACAATGATGGAGATTCCAGCTAAG
CCCAGACCCCGTGGATTCTAGATAGATTTTAGAGGCAGCAGACAGAATTACTGAGGAATTGAGTGTAAGAGTGGAATAAAGTTATCAAGGACAATGCCAAGGGTGGGGCACCCCCAAATTTGACTCTG
GGAGACTCAGCCAAATCCTATCTGGTAATAAAATTTCTTTTTTATTTTTCTTTTCTTTCTTTCTTTCTTTTTTTTTTTTTTGAGTTGGGATCTTGTGCTCTGTCACCCAGGCTGGAGTGCAATGGGCA
CAATTATAGCTCACTGCAGCCTGGAACTCCTGGGATCAAGCCTGGAGTTCCTGCTTCAGCCTCCCTAGTAGCTGGGACTACAGGCATGCACCACCATGCCCAGTTAATAAAATTTCTTCAAATGCA

hide sequence

RefSeq Acc Id:

NM_030760 ⟹ NP_110387

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	10,512,742 - 10,517,447 (-)	NCBI
GRCh37	19	10,623,418 - 10,628,668 (-)	ENTREZGENE
Build 36	19	10,484,623 - 10,489,112 (-)	NCBI Archive
HuRef	19	10,201,961 - 10,207,399 (-)	ENTREZGENE
CHM1_1	19	10,624,176 - 10,628,891 (-)	NCBI
T2T-CHM13v2.0	19	10,639,179 - 10,643,889 (-)	NCBI

Sequence:

show sequence

ACTCGGTTCAAGGCAGCGCGACTGCGGGTGGCGCACGACCAGGGCGCAGACCTTGGGGCGCGCGGCCCATGGAGTCGGGGCTGCTGCGGCCGGCGCCGGTGAGCGAGGTCATCGTCCTGCATTACAAC
TACACCGGCAAGCTCCGCGGTGCGCGCTACCAGCCGGGTGCCGGCCTGCGCGCCGACGCCGTGGTGTGCCTGGCGGTGTGCGCCTTCATCGTGCTAGAGAATCTAGCCGTGTTGTTGGTGCTCGGACG
CCACCCGCGCTTCCACGCTCCCATGTTCCTGCTCCTGGGCAGCCTCACGTTGTCGGATCTGCTGGCAGGCGCCGCCTACGCCGCCAACATCCTACTGTCGGGGCCGCTCACGCTGAAACTGTCCCCCG
CGCTCTGGTTCGCACGGGAGGGAGGCGTCTTCGTGGCACTCACTGCGTCCGTGCTGAGCCTCCTGGCCATCGCGCTGGAGCGCAGCCTCACCATGGCGCGCAGGGGGCCCGCGCCCGTCTCCAGTCGG
GGGCGCACGCTGGCGATGGCAGCCGCGGCCTGGGGCGTGTCGCTGCTCCTCGGGCTCCTGCCAGCGCTGGGCTGGAATTGCCTGGGTCGCCTGGACGCTTGCTCCACTGTCTTGCCGCTCTACGCCAA
GGCCTACGTGCTCTTCTGCGTGCTCGCCTTCGTGGGCATCCTGGCCGCTATCTGTGCACTCTACGCGCGCATCTACTGCCAGGTACGCGCCAACGCGCGGCGCCTGCCGGCACGGCCCGGGACTGCGG
GGACCACCTCGACCCGGGCGCGTCGCAAGCCGCGCTCGCTGGCCTTGCTGCGCACGCTCAGCGTGGTGCTCCTGGCCTTTGTGGCATGTTGGGGCCCCCTCTTCCTGCTGCTGTTGCTCGACGTGGCG
TGCCCGGCGCGCACCTGTCCTGTACTCCTGCAGGCCGATCCCTTCCTGGGACTGGCCATGGCCAACTCACTTCTGAACCCCATCATCTACACGCTCACCAACCGCGACCTGCGCCACGCGCTCCTGCG
CCTGGTCTGCTGCGGACGCCACTCCTGCGGCAGAGACCCGAGTGGCTCCCAGCAGTCGGCGAGCGCGGCTGAGGCTTCCGGGGGCCTGCGCCGCTGCCTGCCCCCGGGCCTTGATGGGAGCTTCAGCG
GCTCGGAGCGCTCATCGCCCCAGCGCGACGGGCTGGACACCAGCGGCTCCACAGGCAGCCCCGGTGCACCCACAGCCGCCCGGACTCTGGTATCAGAACCGGCTGCAGACTGACACCCTCGGCCCACG
ACTGTCTTCCCAAGTTTTACAGACTTGTTCTTTTTACATAAAGGAATTTGTAGGAAATGCAGCCAAAGGTGCAGTCGGAAAAGATGCAGGGGAAATGTATTTATGCAGCGACACCCCACAATGTGAAC
AAACAGACAAAAAATCTGTGCCCTCGTGGAATTGACGTTCTGCTTGGGAACACAGAAAAGAACTCGGTGATGAAATAATGGAGATGATTCCAGTGACAAACGACAGAGATGGTGATGGTGGTCAGGGA
AGACCTCTCTGCAGAGGTAGTGACTTGTGATGTGAGCTGAGACCTCTGTCCTGGGAAGACCAAAAGAAAAGCATTTCAGGATGAGGGAATGGCATGCGCAAAGGCCCTGAGGCTGAAATGTGCCCATG
TGTTCTAAGAAATGCAGCGATGCTGGTGTGCCTGGAGCAGGGACGGAGGGGGAGAATGGGAGGAGACAAGGAGCTGAAGGAGTAGTTCCCGAAGGACCTTGTGGGTGATATAGAGGACTTCGCTTTTG
CTCTGAGTGAGGTGGGAGCCATAGAAGCTTCTAAGCAGAAGAGGGACTTGCCCTAATTCAGGTGATCACAGGTGTCTTGTGGCCTCCATGGGAGGTTGAAAACCAGAGAAGGTGAAGGGGGGCTGCAC
TGAGCCACAGGAACAATGATGGAGATTCCAGCTAAGCCCAGACCCCGTGGATTCTAGATAGATTTTAGAGGCAGCAGACAGAATTACTGAGGAATTGAGTGTAAGAGTGGAATAAAGTTATCAAGGAC
AATGCCAAGGGTGGGGCACCCCCAAATTTGACTCTGGGAGACTCAGCCAAATCCTATCTGGTAATAAAATTTCTTTTTTATTTTTCTTTTCTTTCTTTCTTTCTTTTTTTTTTTTTTGAGTTGGGATC
TTGTGCTCTGTCACCCAGGCTGGAGTGCAATGGGCACAATTATAGCTCACTGCAGCCTGGAACTCCTGGGATCAAGCCTGGAGTTCCTGCTTCAGCCTCCCTAGTAGCTGGGACTACAGGCATGCACC
ACCATGCCCAGTTAATAAAATTTCTTCAAATGCA

hide sequence


Protein RefSeqs	NP_001159687	(Get FASTA)	NCBI Sequence Viewer
	NP_110387	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG38113	(Get FASTA)	NCBI Sequence Viewer
	AAH34703	(Get FASTA)	NCBI Sequence Viewer
	AAH67781	(Get FASTA)	NCBI Sequence Viewer
	AAL57041	(Get FASTA)	NCBI Sequence Viewer
	AAL57042	(Get FASTA)	NCBI Sequence Viewer
	AAL57043	(Get FASTA)	NCBI Sequence Viewer
	AAP20653	(Get FASTA)	NCBI Sequence Viewer
	BAB89315	(Get FASTA)	NCBI Sequence Viewer
	BAC11119	(Get FASTA)	NCBI Sequence Viewer
	CAF85890	(Get FASTA)	NCBI Sequence Viewer
	EAW84113	(Get FASTA)	NCBI Sequence Viewer
	EAW84114	(Get FASTA)	NCBI Sequence Viewer
	EAW84115	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000328472
	ENSP00000328472.3
	ENSP00000416915
	ENSP00000416915.2
GenBank Protein	Q9H228	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_110387 ⟸ NM_030760

- UniProtKB:

Q6NW11 (UniProtKB/Swiss-Prot), Q9H228 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLA
IALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVV
LLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGA
PTAARTLVSEPAAD

hide sequence

RefSeq Acc Id:

NP_001159687 ⟸ NM_001166215

- UniProtKB:

Q6NW11 (UniProtKB/Swiss-Prot), Q9H228 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRH
PRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKA
YVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRL
VCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD

hide sequence

Ensembl Acc Id:

ENSP00000416915 ⟸ ENST00000439028

Ensembl Acc Id:

ENSP00000328472 ⟸ ENST00000333430

Ensembl Acc Id:

ENSP00000481239 ⟸ ENST00000617721

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9H228-F1-model_v2	AlphaFold	Q9H228	1-398	view protein structure

RGD ID:

Promoter ID:

Type:

initiation region

Name:

S1PR5_1

Description:

sphingosine-1-phosphate receptor 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H25003

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	10,517,447 - 10,517,507	EPDNEW

RGD ID:

Promoter ID:

Type:

initiation region

Name:

S1PR5_2

Description:

sphingosine-1-phosphate receptor 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H25002

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	10,517,950 - 10,518,010	EPDNEW

Database	Acc Id	Source(s)
COSMIC	S1PR5	COSMIC
Ensembl Genes	ENSG00000180739	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000333430	ENTREZGENE
	ENST00000333430.6	UniProtKB/Swiss-Prot
	ENST00000439028	ENTREZGENE
	ENST00000439028.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
GTEx	ENSG00000180739	GTEx
HGNC ID	HGNC:14299	ENTREZGENE
Human Proteome Map	S1PR5	Human Proteome Map
InterPro	EDG8_S1P_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	S1P_rcpt	UniProtKB/Swiss-Prot
KEGG Report	hsa:53637	UniProtKB/Swiss-Prot
NCBI Gene	53637	ENTREZGENE
OMIM	605146	OMIM
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	PA162402378	PharmGKB
PRINTS	EDG8RECEPTOR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	S1PRECEPTOR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	K7EIT5_HUMAN	UniProtKB/TrEMBL
	L8ECK7_HUMAN	UniProtKB/TrEMBL
	Q6NW11	ENTREZGENE
	Q9H228	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q6NW11	UniProtKB/Swiss-Prot