PTGER1 (prostaglandin E receptor 1)

Advanced Search (OLGA)

Gene: PTGER1 (prostaglandin E receptor 1) Homo sapiens

Analyze

Symbol:

PTGER1

Name:

prostaglandin E receptor 1

RGD ID:

733054

HGNC Page

HGNC:9593

Description:

Enables prostaglandin E receptor activity. Involved in response to prostaglandin E. Is active in plasma membrane.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

EP1; PGE receptor EP1 subtype; PGE receptor, EP1 subtype; PGE2 receptor EP1 subtype; prostaglandin E receptor 1 (subtype EP1), 42kD; prostaglandin E receptor 1 (subtype EP1), 42kDa; prostaglandin E receptor 1, subtype EP1; prostaglandin E2 receptor EP1 subtype; prostanoid EP1 receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	14,472,466 - 14,475,354 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	14,472,466 - 14,475,354 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	14,583,278 - 14,586,166 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	14,444,278 - 14,447,174 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	14,444,278 - 14,447,174	NCBI
Celera	19	14,477,399 - 14,480,295 (-)	NCBI		Celera
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	14,153,393 - 14,156,289 (-)	NCBI		HuRef
CHM1_1	19	14,583,257 - 14,586,164 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	14,599,099 - 14,601,987 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenocarcinoma (EXP)

Animal Mammary Neoplasms (EXP)

Experimental Mammary Neoplasms (EXP)

gastric ulcer (ISO)

hydronephrosis (EXP)

Hyperalgesia (EXP)

invasive ductal carcinoma (EXP)

sexual dysfunction (EXP)

squamous cell carcinoma (EXP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (ISO)

antirheumatic drug (EXP)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

C60 fullerene (ISO)

cadmium dichloride (ISO)

calcium atom (ISO)

calcium(0) (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

CGP 52608 (EXP)

cyclophosphamide (ISO)

D-glucose (ISO)

D-mannitol (ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (ISO)

endosulfan (ISO)

ethanol (ISO)

folic acid (ISO)

formaldehyde (ISO)

genistein (EXP)

gentamycin (ISO)

glucose (ISO)

graphite (ISO)

Licochalcone B (EXP)

mifepristone (ISO)

misoprostol (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP)

naphthalene (ISO)

okadaic acid (ISO)

Osajin (EXP)

paracetamol (ISO)

paraquat (ISO)

PhIP (ISO)

phosgene (ISO)

Pomiferin (EXP)

pristane (ISO)

progesterone (ISO)

prostaglandin E2 (EXP,ISO)

puerarin (EXP)

resveratrol (EXP)

Rosavin (EXP)

silicon dioxide (EXP)

silver atom (ISO)

silver(0) (ISO)

sirolimus (EXP)

sodium arsenite (EXP,ISO)

tetrachloromethane (ISO)

thioacetamide (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

vinyl carbamate (ISO)

wortmannin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating dopamine receptor signaling pathway (IEA)

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA)

G protein-coupled receptor signaling pathway (IEA,TAS)

inflammatory response (IBA)

phospholipase C-activating G protein-coupled receptor signaling pathway (TAS)

positive regulation of cytosolic calcium ion concentration (IBA)

response to lipopolysaccharide (IEA,ISO)

response to prostaglandin E (IDA)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IDA,IEA,TAS)

Molecular Function

D1 dopamine receptor binding (IEA)

G protein-coupled receptor activity (IEA)

prostaglandin E receptor activity (IBA,IDA,IEA,ISO,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	The roles of prostaglandin E receptor subtypes in the cytoprotective action of prostaglandin E2 in rat stomach.	Araki H, etal., Aliment Pharmacol Ther. 2000 Apr;14 Suppl 1:116-24.
2.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1160156	PMID:7759114	PMID:7938166	PMID:8253813	PMID:11235015	PMID:11951086	PMID:12477932	PMID:12642666	PMID:12788892	PMID:12841871	PMID:14562138	PMID:14744769
PMID:15489334	PMID:15886234	PMID:16393343	PMID:16670773	PMID:16754659	PMID:17496729	PMID:17525067	PMID:17611676	PMID:17877755	PMID:17906615	PMID:18516068	PMID:19064572
PMID:19336370	PMID:19625175	PMID:19913121	PMID:20178602	PMID:20452482	PMID:20587336	PMID:20628086	PMID:20647315	PMID:20673868	PMID:20858737	PMID:21052031	PMID:21447366
PMID:21813027	PMID:21873635	PMID:22110249	PMID:22162473	PMID:22276108	PMID:22474323	PMID:22555372	PMID:22924768	PMID:23494562	PMID:23525457	PMID:23842570	PMID:24333447
PMID:24614038	PMID:25289898	PMID:26211005	PMID:26959713	PMID:27818595	PMID:29134301	PMID:29676528	PMID:34822808	PMID:36724073	PMID:38753641

Genomics

Comparative Map Data

PTGER1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	14,472,466 - 14,475,354 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	14,472,466 - 14,475,354 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	14,583,278 - 14,586,166 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	14,444,278 - 14,447,174 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	14,444,278 - 14,447,174	NCBI
Celera	19	14,477,399 - 14,480,295 (-)	NCBI		Celera
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	14,153,393 - 14,156,289 (-)	NCBI		HuRef
CHM1_1	19	14,583,257 - 14,586,164 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	14,599,099 - 14,601,987 (-)	NCBI		T2T-CHM13v2.0

Ptger1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	84,393,171 - 84,399,385 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	84,393,307 - 84,399,382 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	83,666,644 - 83,672,756 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	83,666,678 - 83,672,753 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	86,190,539 - 86,194,002 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	86,556,745 - 86,560,208 (+)	NCBI		MGSCv36	mm8
Celera	8	87,957,431 - 87,960,894 (+)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI
cM Map	8	40.22	NCBI

Ptger1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	41,374,983 - 41,379,593 (-)	NCBI		GRCr8
mRatBN7.2	19	24,470,258 - 24,473,687 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	24,467,532 - 24,473,559 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	31,291,382 - 31,294,683 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	31,945,803 - 31,949,104 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	34,168,630 - 34,171,931 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	24,799,422 - 24,803,373 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	24,800,072 - 24,803,373 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	35,779,098 - 35,782,528 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	26,160,729 - 26,163,156 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	26,165,447 - 26,167,982 (-)	NCBI
Celera	19	24,013,194 - 24,016,495 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

Ptger1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	33,063,052 - 33,067,580 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	33,063,052 - 33,067,580 (-)	NCBI	ChiLan1.0	ChiLan1.0

PTGER1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	19,402,243 - 19,406,282 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	18,404,124 - 18,407,438 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	14,035,876 - 14,038,812 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	14,879,798 - 14,881,969 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

PTGER1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	48,156,055 - 48,159,838 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	48,157,973 - 48,159,921 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	48,030,811 - 48,039,003 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	48,673,636 - 48,681,830 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	48,661,602 - 48,678,490 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	47,888,190 - 47,893,357 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	48,311,534 - 48,319,721 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	48,554,374 - 48,562,556 (+)	NCBI		UU_Cfam_GSD_1.0

Ptger1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	207,335,030 - 207,342,686 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	3,012,012 - 3,018,275 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	3,014,633 - 3,018,617 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTGER1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	64,797,216 - 64,800,458 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	64,796,944 - 64,800,199 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	65,154,866 - 65,156,438 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTGER1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	13,131,328 - 13,134,457 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	13,131,424 - 13,133,190 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	6,519,439 - 6,524,611 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in PTGER1
37 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 19p13.2-13.12(chr19:12132052-14751798)x3	copy number gain	See cases [RCV000052910]	Chr19:12132052..14751798 [GRCh38] Chr19:12242867..14862610 [GRCh37] Chr19:12103867..14723610 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.12-q11(chr19:13974677-27839676)x3	copy number gain	See cases [RCV000052912]	Chr19:13974677..27839676 [GRCh38] Chr19:14085489..28330584 [GRCh37] Chr19:13946489..33022424 [NCBI36] Chr19:19p13.12-q11	pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:11227942-14532135)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053944]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053944]\|See cases [RCV000053944]	Chr19:11227942..14532135 [GRCh38] Chr19:11338618..14642947 [GRCh37] Chr19:11199618..14503947 [NCBI36] Chr19:19p13.2-13.12	pathogenic
NM_002741.3(PKN1):c.2096C>T (p.Ala699Val)	single nucleotide variant	Malignant melanoma [RCV000071955]	Chr19:14469460 [GRCh38] Chr19:14580272 [GRCh37] Chr19:14441272 [NCBI36] Chr19:19p13.12	not provided
GRCh38/hg38 19p13.2-q13.31(chr19:11227942-44626354)x3	copy number gain	See cases [RCV000133888]	Chr19:11227942..44626354 [GRCh38] Chr19:11338618..45129651 [GRCh37] Chr19:11199618..49821491 [NCBI36] Chr19:19p13.2-q13.31	pathogenic
GRCh38/hg38 19p13.12-13.11(chr19:14154962-16914313)x1	copy number loss	See cases [RCV000134176]	Chr19:14154962..16914313 [GRCh38] Chr19:14265774..17025123 [GRCh37] Chr19:14126774..16886123 [NCBI36] Chr19:19p13.12-13.11	pathogenic
GRCh38/hg38 19p13.13-13.12(chr19:13533925-15371089)x1	copy number loss	See cases [RCV000136502]	Chr19:13533925..15371089 [GRCh38] Chr19:13644739..15481900 [GRCh37] Chr19:13505739..15342900 [NCBI36] Chr19:19p13.13-13.12	pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:12580427-14742673)x1	copy number loss	See cases [RCV000135937]	Chr19:12580427..14742673 [GRCh38] Chr19:12691241..14853485 [GRCh37] Chr19:12552241..14714485 [NCBI36] Chr19:19p13.2-13.12	pathogenic\|likely pathogenic
GRCh38/hg38 19p13.12(chr19:14406909-15410770)x1	copy number loss	See cases [RCV000136896]	Chr19:14406909..15410770 [GRCh38] Chr19:14517721..15521581 [GRCh37] Chr19:14378721..15382581 [NCBI36] Chr19:19p13.12	uncertain significance
GRCh37/hg19 19p13.2-13.12(chr19:9678768-14853426)	copy number gain	See cases [RCV000446985]	Chr19:9678768..14853426 [GRCh37] Chr19:19p13.2-13.12	pathogenic
GRCh37/hg19 19p13.12-13.11(chr19:14124666-16431349)x1	copy number loss	See cases [RCV000448818]	Chr19:14124666..16431349 [GRCh37] Chr19:19p13.12-13.11	pathogenic
GRCh37/hg19 19p13.12(chr19:14580590-14588566)x3	copy number gain	See cases [RCV000447728]	Chr19:14580590..14588566 [GRCh37] Chr19:19p13.12	likely benign
GRCh37/hg19 19p13.2-13.12(chr19:13592592-14717528)x1	copy number loss	See cases [RCV000511445]	Chr19:13592592..14717528 [GRCh37] Chr19:19p13.2-13.12	likely pathogenic
GRCh37/hg19 19p13.2-13.12(chr19:12574343-14726197)x1	copy number loss	See cases [RCV000511130]	Chr19:12574343..14726197 [GRCh37] Chr19:19p13.2-13.12	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)x3	copy number gain	See cases [RCV000511289]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic\|uncertain significance
NM_000955.3(PTGER1):c.1129G>A (p.Ala377Thr)	single nucleotide variant	not specified [RCV004295289]	Chr19:14472640 [GRCh38] Chr19:14583452 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1112G>C (p.Gly371Ala)	single nucleotide variant	not specified [RCV004299516]	Chr19:14472657 [GRCh38] Chr19:14583469 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.481G>C (p.Val161Leu)	single nucleotide variant	not specified [RCV004312531]	Chr19:14473840 [GRCh38] Chr19:14584652 [GRCh37] Chr19:19p13.12	likely benign
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)	copy number gain	See cases [RCV000512296]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-59097160)x3	copy number gain	not provided [RCV000752444]	Chr19:260912..59097160 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:68029-59110290)x3	copy number gain	not provided [RCV000752439]	Chr19:68029..59110290 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.12(chr19:14368330-15712368)x1	copy number loss	not provided [RCV001007034]	Chr19:14368330..15712368 [GRCh37] Chr19:19p13.12	pathogenic
GRCh37/hg19 19p13.12-12(chr19:14286624-20956753)x3	copy number gain	not provided [RCV001259370]	Chr19:14286624..20956753 [GRCh37] Chr19:19p13.12-12	pathogenic
GRCh37/hg19 19p13.12-13.11(chr19:14124666-16431349)	copy number loss	not specified [RCV002052675]	Chr19:14124666..16431349 [GRCh37] Chr19:19p13.12-13.11	pathogenic
NM_000955.3(PTGER1):c.422G>A (p.Arg141Gln)	single nucleotide variant	not specified [RCV004312530]	Chr19:14473899 [GRCh38] Chr19:14584711 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.610G>A (p.Ala204Thr)	single nucleotide variant	not specified [RCV004161685]	Chr19:14473711 [GRCh38] Chr19:14584523 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1079G>A (p.Arg360His)	single nucleotide variant	not specified [RCV004221638]	Chr19:14472690 [GRCh38] Chr19:14583502 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.274G>A (p.Gly92Ser)	single nucleotide variant	not specified [RCV004109748]	Chr19:14474047 [GRCh38] Chr19:14584859 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1040A>C (p.Asp347Ala)	single nucleotide variant	not specified [RCV004174385]	Chr19:14472729 [GRCh38] Chr19:14583541 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.56C>T (p.Ala19Val)	single nucleotide variant	not specified [RCV004192818]	Chr19:14474265 [GRCh38] Chr19:14585077 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.188G>T (p.Arg63Leu)	single nucleotide variant	not specified [RCV004071361]	Chr19:14474133 [GRCh38] Chr19:14584945 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1055T>C (p.Ile352Thr)	single nucleotide variant	not specified [RCV004158889]	Chr19:14472714 [GRCh38] Chr19:14583526 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.235A>G (p.Ser79Gly)	single nucleotide variant	not specified [RCV004227172]	Chr19:14474086 [GRCh38] Chr19:14584898 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.460G>A (p.Ala154Thr)	single nucleotide variant	not specified [RCV004202374]	Chr19:14473861 [GRCh38] Chr19:14584673 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.791C>T (p.Ser264Leu)	single nucleotide variant	not specified [RCV004231896]	Chr19:14473530 [GRCh38] Chr19:14584342 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.452T>G (p.Val151Gly)	single nucleotide variant	not specified [RCV004226404]	Chr19:14473869 [GRCh38] Chr19:14584681 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.479C>T (p.Ala160Val)	single nucleotide variant	not specified [RCV004241703]	Chr19:14473842 [GRCh38] Chr19:14584654 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.248C>A (p.Thr83Asn)	single nucleotide variant	not specified [RCV004167746]	Chr19:14474073 [GRCh38] Chr19:14584885 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.713C>A (p.Ser238Tyr)	single nucleotide variant	not specified [RCV004150156]	Chr19:14473608 [GRCh38] Chr19:14584420 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1103C>G (p.Pro368Arg)	single nucleotide variant	not specified [RCV004116585]	Chr19:14472666 [GRCh38] Chr19:14583478 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.388G>A (p.Gly130Ser)	single nucleotide variant	not specified [RCV004212470]	Chr19:14473933 [GRCh38] Chr19:14584745 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.440C>T (p.Ala147Val)	single nucleotide variant	not specified [RCV004237856]	Chr19:14473881 [GRCh38] Chr19:14584693 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.725C>T (p.Pro242Leu)	single nucleotide variant	not specified [RCV004249788]	Chr19:14473596 [GRCh38] Chr19:14584408 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.273G>T (p.Pro91=)	single nucleotide variant	not provided [RCV003421869]	Chr19:14474048 [GRCh38] Chr19:14584860 [GRCh37] Chr19:19p13.12	likely benign
NM_000955.3(PTGER1):c.322G>C (p.Gly108Arg)	single nucleotide variant	not specified [RCV004362030]	Chr19:14473999 [GRCh38] Chr19:14584811 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.589G>T (p.Gly197Cys)	single nucleotide variant	not specified [RCV004341354]	Chr19:14473732 [GRCh38] Chr19:14584544 [GRCh37] Chr19:19p13.12	uncertain significance
GRCh37/hg19 19p13.13-13.11(chr19:13970692-18139376)x3	copy number gain	not specified [RCV003986122]	Chr19:13970692..18139376 [GRCh37] Chr19:19p13.13-13.11	uncertain significance
NM_000955.3(PTGER1):c.533G>T (p.Arg178Leu)	single nucleotide variant	not specified [RCV004515597]	Chr19:14473788 [GRCh38] Chr19:14584600 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1169C>G (p.Ser390Trp)	single nucleotide variant	not specified [RCV004515592]	Chr19:14472600 [GRCh38] Chr19:14583412 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.16C>T (p.Pro6Ser)	single nucleotide variant	not specified [RCV004515593]	Chr19:14474305 [GRCh38] Chr19:14585117 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.184G>T (p.Gly62Cys)	single nucleotide variant	not specified [RCV004515594]	Chr19:14474137 [GRCh38] Chr19:14584949 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.46A>G (p.Thr16Ala)	single nucleotide variant	not specified [RCV004515596]	Chr19:14474275 [GRCh38] Chr19:14585087 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.700T>A (p.Trp234Arg)	single nucleotide variant	not specified [RCV004515599]	Chr19:14473621 [GRCh38] Chr19:14584433 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.709C>G (p.Arg237Gly)	single nucleotide variant	not specified [RCV004515600]	Chr19:14473612 [GRCh38] Chr19:14584424 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.716G>A (p.Arg239Gln)	single nucleotide variant	not specified [RCV004515601]	Chr19:14473605 [GRCh38] Chr19:14584417 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.398T>C (p.Val133Ala)	single nucleotide variant	not specified [RCV004515595]	Chr19:14473923 [GRCh38] Chr19:14584735 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.580C>A (p.Pro194Thr)	single nucleotide variant	not specified [RCV004515598]	Chr19:14473741 [GRCh38] Chr19:14584553 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.1165A>G (p.Ser389Gly)	single nucleotide variant	not specified [RCV004515591]	Chr19:14472604 [GRCh38] Chr19:14583416 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.851C>T (p.Ser284Leu)	single nucleotide variant	not specified [RCV004515602]	Chr19:14473470 [GRCh38] Chr19:14584282 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.926G>A (p.Cys309Tyr)	single nucleotide variant	not specified [RCV004666858]	Chr19:14473395 [GRCh38] Chr19:14584207 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.55G>A (p.Ala19Thr)	single nucleotide variant	not specified [RCV004666857]	Chr19:14474266 [GRCh38] Chr19:14585078 [GRCh37] Chr19:19p13.12	uncertain significance
NM_000955.3(PTGER1):c.964G>C (p.Gly322Arg)	single nucleotide variant	not specified [RCV004657952]	Chr19:14472805 [GRCh38] Chr19:14583617 [GRCh37] Chr19:19p13.12	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	324
Count of miRNA genes:	302
Interacting mature miRNAs:	323
Transcripts:	ENST00000292513
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298499	UAE1_H	Urinary albumin excretion QTL 1 (human)	2.73	0.0009	Urinary albumin excretion	urine albumin:creatinine ratio (ACR)	19	1	16075902	Human
1300034	BP50_H	Blood pressure QTL 50 (human)	2.1	0.00094	Blood pressure	systolic	19	11089463	37089463	Human
1643451	SLIPL6_H	Serum lipid level QTL 6 (human)	2.19	0.0008	Lipid level		19	1	16075902	Human
1581534	BP76_H	Blood pressure QTL 76 (human)	2	0.001	Blood pressure	pulse pressure	19	1	16075902	Human
1581535	BP65_H	Blood pressure QTL 65 (human)	3.1	0.001	Blood pressure	pulse pressure	19	1	16075902	Human
2314591	INSUL4_H	Insulin level QTL 4 (human)	3.8	0.000038	Insulin level	fasting	19	1	16075902	Human
1298476	BP3_H	Blood pressure QTL 3 (human)	2.4		Blood pressure	systolic	19	1	16075902	Human

Markers in Region

RH71361

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	14,583,373 - 14,583,553	UniSTS	GRCh37
Build 36	19	14,444,373 - 14,444,553	RGD	NCBI36
Celera	19	14,477,494 - 14,477,674	RGD
Cytogenetic Map	19	p13.1	UniSTS
HuRef	19	14,153,488 - 14,153,668	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1196	2412	2566	1995	4844	1661	2271	5	571	1142	416	2174	5978	5420	48	3695	776	1692	1584	169	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_000955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB065464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC008569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY275470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC029768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC039034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC051286	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L22647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000292513 ⟹ ENSP00000292513

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	19	14,472,466 - 14,475,354 (-)	Ensembl

RefSeq Acc Id:

NM_000955 ⟹ NP_000946

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	14,472,466 - 14,475,354 (-)	NCBI
GRCh37	19	14,583,278 - 14,586,174 (-)	ENTREZGENE
Build 36	19	14,444,278 - 14,447,174 (-)	NCBI Archive
HuRef	19	14,153,393 - 14,156,289 (-)	ENTREZGENE
CHM1_1	19	14,583,257 - 14,586,164 (-)	NCBI
T2T-CHM13v2.0	19	14,599,099 - 14,601,987 (-)	NCBI

Sequence:

show sequence

GAGGGAGGAAGCGGCTTGCCGGAGAGCCAGGGCGCAGTGGGCGGCAGGGCTGAGCGGCCGGTGA
TGGGGACCCCACATCCCAGGCAGTGCCGGCACCCCTGGCGCCTGACATGAGCCCTTGCGGGCCC
CTCAACCTGAGCCTGGCGGGCGAGGCGACCACATGCGCGGCGCCCTGGGTCCCCAACACGTCGG
CCGTGCCGCCGTCGGGCGCTTCGCCCGCGCTGCCCATCTTCTCCATGACGCTGGGCGCCGTGTC
CAACCTGCTGGCGCTGGCGCTGCTGGCGCAGGCCGCGGGCCGCCTGCGACGCCGCCGCTCGGCC
GCCACCTTCCTGCTGTTCGTGGCCAGCCTGCTGGCCACCGACCTGGCGGGCCACGTGATCCCGG
GCGCGCTGGTGCTGCGTCTGTACACTGCGGGGCGCGCTCCGGCCGGCGGGGCCTGCCACTTCCT
GGGCGGCTGCATGGTCTTCTTCGGCCTGTGCCCGCTGCTGCTGGGCTGTGGCATGGCCGTGGAG
CGCTGCGTGGGCGTCACGCGGCCGCTGCTCCACGCCGCGCGGGTCTCGGTCGCCCGCGCGCGCC
TGGCGCTGGCCGCGGTGGCCGCGGTGGCCTTGGCCGTGGCGCTGCTGCCGCTGGCGCGCGTGGG
CCGCTATGAGCTGCAGTACCCGGGCACGTGGTGCTTCATCGGCCTGGGTCCCCCGGGCGGCTGG
CGCCAGGCACTGCTTGCTGGCCTCTTCGCCAGCCTCGGCCTGGTCGCGCTCCTCGCCGCGCTGG
TGTGCAACACGCTCAGCGGCCTGGCCCTGCTACGCGCCCGCTGGCGACGCCGCTCCCGACGGCC
TCCCCCGGCCTCAGGCCCCGACAGCCGGCGTCGCTGGGGGGCGCACGGACCCCGCTCGGCCTCC
GCCTCGTCCGCCTCGTCCATCGCTTCGGCCTCCACCTTCTTTGGCGGCTCTCGGAGCAGCGGCT
CGGCACGCAGAGCTCGCGCCCACGACGTGGAGATGGTGGGCCAGCTTGTCGGTATCATGGTGGT
GTCGTGCATCTGCTGGAGCCCAATGCTGGTGTTGGTGGCGCTGGCCGTCGGCGGCTGGAGCTCT
ACCTCCCTGCAGCGGCCACTGTTCCTGGCCGTGCGCCTTGCCTCCTGGAACCAGATCCTGGACC
CTTGGGTGTACATCCTACTGCGCCAGGCCGTGCTGCGCCAACTGCTTCGCCTCTTGCCCCCGAG
GGCCGGAGCCAAGGGCGGCCCCGCGGGGCTGGGCCTAACACCGAGCGCCTGGGAGGCCAGCTCG
CTGCGCAGCTCCCGGCACAGCGGCCTCAGCCACTTCTAAGCACAACCAGAGGCCCAACGACTAA
GCCAGCCCACCCTGGGCTGGGCCCAGGTGCGCGGCGCAGAGCCTTTGGGAATAAAAAGCCATTC
TGCGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_000946	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC37539	(Get FASTA)	NCBI Sequence Viewer
	AAH29768	(Get FASTA)	NCBI Sequence Viewer
	AAH39034	(Get FASTA)	NCBI Sequence Viewer
	AAH51286	(Get FASTA)	NCBI Sequence Viewer
	AAP32302	(Get FASTA)	NCBI Sequence Viewer
	BAC05723	(Get FASTA)	NCBI Sequence Viewer
	EAW84422	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000292513
	ENSP00000292513.3
GenBank Protein	P34995	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_000946 ⟸ NM_000955

- UniProtKB:

Q86VB5 (UniProtKB/Swiss-Prot), Q86UH3 (UniProtKB/Swiss-Prot), Q5U5U4 (UniProtKB/Swiss-Prot), Q8NHB2 (UniProtKB/Swiss-Prot), P34995 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQAAGRL
RRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFFGLCPLLLG
CGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGL
GPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRRPPPASGPDSRRRWGAH
GPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLVGIMVVSCICWSPMLVLVALA
VGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPS
AWEASSLRSSRHSGLSHF

hide sequence

Ensembl Acc Id:

ENSP00000292513 ⟸ ENST00000292513

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P34995-F1-model_v2	AlphaFold	P34995	1-402	view protein structure

Promoters

RGD ID:

6795955

Promoter ID:

HG_KWN:29113

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562

Transcripts:

NM_000955

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	19	14,447,106 - 14,447,817 (-)	MPROMDB

RGD ID:

7238839

Promoter ID:

EPDNEW_H25165

Type:

initiation region

Name:

PTGER1_1

Description:

prostaglandin E receptor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	14,475,337 - 14,475,397	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:9593	AgrOrtholog
COSMIC	PTGER1	COSMIC
Ensembl Genes	ENSG00000160951	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000292513	ENTREZGENE
	ENST00000292513.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000160951	GTEx
HGNC ID	HGNC:9593	ENTREZGENE
Human Proteome Map	PTGER1	Human Proteome Map
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Prostanoid_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prostglndn_DP_rcpt	UniProtKB/Swiss-Prot
	Prostglndn_EP1_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:5731	UniProtKB/Swiss-Prot
NCBI Gene	5731	ENTREZGENE
OMIM	176802	OMIM
PANTHER	PTHR11866	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11866:SF3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	PA286	PharmGKB
PRINTS	PROSTAGLNDNR	UniProtKB/Swiss-Prot
	PROSTANOIDR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PRSTNOIDEP1R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	P34995	ENTREZGENE, UniProtKB/Swiss-Prot
	Q05C32_HUMAN	UniProtKB/TrEMBL
	Q5U5U4	ENTREZGENE
	Q86UH3	ENTREZGENE
	Q86VB5	ENTREZGENE
	Q8NHB2	ENTREZGENE
UniProt Secondary	Q5U5U4	UniProtKB/Swiss-Prot
	Q86UH3	UniProtKB/Swiss-Prot
	Q86VB5	UniProtKB/Swiss-Prot
	Q8NHB2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-17	PTGER1	prostaglandin E receptor 1	PTGER1	prostaglandin E receptor 1 (subtype EP1), 42kDa	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD