Symbol:
CPZ
Name:
carboxypeptidase Z
RGD ID:
731300
HGNC Page
HGNC:2333
Description:
Predicted to enable metallocarboxypeptidase activity. Predicted to be involved in peptide metabolic process and protein processing. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
metallocarboxypeptidase Z; MGC99682; VEZT/CPZ fusion
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Cpz (carboxypeptidase Z) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Cpz (carboxypeptidase Z) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Cpz (carboxypeptidase Z) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
CPZ (carboxypeptidase Z) NCBI
Ortholog
Canis lupus familiaris (dog):
CPZ (carboxypeptidase Z) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cpz (carboxypeptidase Z) NCBI
Ortholog
Sus scrofa (pig):
CPZ (carboxypeptidase Z) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
CPZ (carboxypeptidase Z) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Cpz (carboxypeptidase Z) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Nkx2-6 (NK2 homeobox 6) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cpz (carboxypeptidase Z)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cpz (carboxypeptidase Z)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cpz (carboxypeptidase Z)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
egl-21
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Xenopus laevis (African clawed frog):
cpz.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
cpz
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
cpz.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 8,592,765 - 8,619,752 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 8,592,660 - 8,619,759 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 8,594,492 - 8,621,479 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 8,645,335 - 8,672,388 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 8,712,592 - 8,739,547 NCBI Celera 4 8,487,239 - 8,514,366 (+) NCBI Celera Cytogenetic Map 4 p16.1 NCBI HuRef 4 8,513,792 - 8,540,980 (+) NCBI HuRef CHM1_1 4 8,592,625 - 8,619,813 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 8,572,626 - 8,599,700 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
CPZ Human (1->4)-beta-D-glucan multiple interactions ISO Cpz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CPZ mRNA CTD PMID:36331819 CPZ Human 17beta-estradiol multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of CPZ mRNA CTD PMID:17404688 CPZ Human 17beta-estradiol affects expression ISO Cpz (Rattus norvegicus) 6480464 Estradiol affects the expression of CPZ mRNA CTD PMID:32145629 CPZ Human 17beta-estradiol multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CPZ mRNA CTD PMID:32741896 CPZ Human 17beta-estradiol 3-benzoate multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CPZ mRNA CTD PMID:32741896 CPZ Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cpz (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CPZ mRNA CTD PMID:32109520 CPZ Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cpz (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of CPZ mRNA CTD PMID:34747641 CPZ Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cpz (Mus musculus) 6480464 2 more ... CTD PMID:38648751 CPZ Human 2,6-dinitrotoluene affects expression ISO Cpz (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of CPZ mRNA CTD PMID:21346803 CPZ Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Cpz (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 CPZ Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CPZ mRNA CTD PMID:28628672 CPZ Human 4,4'-sulfonyldiphenol increases expression ISO Cpz (Mus musculus) 6480464 bisphenol S results in increased expression of CPZ mRNA CTD PMID:30951980 and PMID:39298647 CPZ Human 4,4'-sulfonyldiphenol affects methylation ISO Cpz (Mus musculus) 6480464 bisphenol S affects the methylation of CPZ gene CTD PMID:31683443 CPZ Human 4,4'-sulfonyldiphenol decreases methylation ISO Cpz (Mus musculus) 6480464 bisphenol S results in decreased methylation of CPZ exon CTD PMID:33297965 CPZ Human 6-propyl-2-thiouracil decreases expression ISO Cpz (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of CPZ mRNA CTD PMID:24780913 more ... CPZ Human 6-propyl-2-thiouracil multiple interactions ISO Cpz (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of CPZ mRNA CTD PMID:36706583 CPZ Human acetamide increases expression ISO Cpz (Rattus norvegicus) 6480464 acetamide results in increased expression of CPZ mRNA CTD PMID:31881176 CPZ Human acrylamide decreases expression ISO Cpz (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of CPZ mRNA CTD PMID:28959563 CPZ Human Aflatoxin B2 alpha increases methylation EXP 6480464 aflatoxin B2 results in increased methylation of CPZ intron CTD PMID:30157460 CPZ Human alachlor increases expression ISO Cpz (Rattus norvegicus) 6480464 alachlor results in increased expression of CPZ mRNA CTD PMID:12419858 CPZ Human all-trans-retinoic acid multiple interactions ISO Cpz (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of CPZ mRNA CTD PMID:30951980 CPZ Human alpha-Zearalanol multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPZ mRNA CTD PMID:35163327 CPZ Human amitrole decreases expression ISO Cpz (Rattus norvegicus) 6480464 Amitrole results in decreased expression of CPZ mRNA CTD PMID:30047161 CPZ Human ammonium chloride affects expression ISO Cpz (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of CPZ mRNA CTD PMID:16483693 CPZ Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of CPZ mRNA CTD PMID:24449571 CPZ Human atrazine affects methylation ISO Cpz (Rattus norvegicus) 6480464 Atrazine affects the methylation of CPZ gene CTD PMID:35440735 CPZ Human benzo[a]pyrene increases mutagenesis EXP 6480464 Benzo(a)pyrene results in increased mutagenesis of CPZ gene CTD PMID:25435355 CPZ Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of CPZ 5' UTR more ... CTD PMID:27901495 and PMID:30157460 CPZ Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of CPZ promoter CTD PMID:27901495 CPZ Human benzo[a]pyrene decreases expression ISO Cpz (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CPZ mRNA CTD PMID:22228805 CPZ Human benzo[a]pyrene decreases expression ISO Cpz (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of CPZ mRNA CTD PMID:21839799 CPZ Human benzo[e]pyrene increases methylation EXP 6480464 benzo(e)pyrene results in increased methylation of CPZ intron CTD PMID:30157460 CPZ Human Benzo[ghi]perylene increases expression ISO Cpz (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of CPZ mRNA CTD PMID:26377693 CPZ Human Benzo[k]fluoranthene increases expression ISO Cpz (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of CPZ mRNA CTD PMID:26377693 CPZ Human beta-naphthoflavone multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CPZ mRNA CTD PMID:18164116 CPZ Human bis(2-ethylhexyl) phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human bisphenol A affects expression ISO Cpz (Rattus norvegicus) 6480464 bisphenol A affects the expression of CPZ mRNA CTD PMID:25181051 and PMID:32145629 CPZ Human bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of CPZ gene CTD PMID:31601247 CPZ Human bisphenol A decreases expression ISO Cpz (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CPZ mRNA CTD PMID:30816183 more ... CPZ Human bisphenol A increases expression ISO Cpz (Mus musculus) 6480464 bisphenol A results in increased expression of CPZ mRNA CTD PMID:30951980 and PMID:32156529 CPZ Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CPZ gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CPZ mRNA CTD PMID:28628672 and PMID:31601247 CPZ Human bisphenol A increases methylation ISO Cpz (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of CPZ gene CTD PMID:28505145 CPZ Human bisphenol F increases expression ISO Cpz (Mus musculus) 6480464 bisphenol F results in increased expression of CPZ mRNA CTD PMID:30951980 CPZ Human bisphenol F decreases expression ISO Cpz (Mus musculus) 6480464 bisphenol F results in decreased expression of CPZ mRNA CTD PMID:36706583 CPZ Human bisphenol F multiple interactions ISO Cpz (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of CPZ mRNA CTD PMID:30951980 CPZ Human Butylbenzyl phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human calcitriol decreases expression EXP 6480464 Calcitriol results in decreased expression of CPZ mRNA CTD PMID:26485663 CPZ Human carbon nanotube increases expression ISO Cpz (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 CPZ Human choline multiple interactions ISO Cpz (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPZ mRNA CTD PMID:20938992 CPZ Human clotrimazole decreases expression ISO Cpz (Rattus norvegicus) 6480464 Clotrimazole results in decreased expression of CPZ mRNA CTD PMID:30047161 CPZ Human Cuprizon increases expression ISO Cpz (Rattus norvegicus) 6480464 Cuprizone results in increased expression of CPZ mRNA CTD PMID:26577399 CPZ Human cytarabine decreases expression EXP 6480464 Cytarabine results in decreased expression of CPZ mRNA CTD PMID:21198554 CPZ Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CPZ mRNA CTD PMID:28628672 CPZ Human dibutyl phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human diethyl phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human diiodine multiple interactions ISO Cpz (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of CPZ mRNA CTD PMID:36706583 CPZ Human diisobutyl phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human diisononyl phthalate multiple interactions ISO Cpz (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of CPZ mRNA CTD PMID:39150890 CPZ Human flavonoids decreases expression ISO Cpz (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of CPZ mRNA CTD PMID:18035473 CPZ Human folic acid multiple interactions ISO Cpz (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPZ mRNA CTD PMID:20938992 CPZ Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of CPZ mRNA CTD PMID:28937961 CPZ Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CPZ gene CTD PMID:31601247 CPZ Human furan decreases methylation ISO Cpz (Rattus norvegicus) 6480464 furan results in decreased methylation of CPZ gene CTD PMID:27387713 CPZ Human furan increases expression ISO Cpz (Rattus norvegicus) 6480464 furan results in increased expression of CPZ mRNA CTD PMID:27387713 CPZ Human gentamycin decreases expression ISO Cpz (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of CPZ mRNA CTD PMID:22061828 CPZ Human graphite affects expression ISO Cpz (Rattus norvegicus) 6480464 Graphite affects the expression of CPZ mRNA CTD PMID:29933104 CPZ Human indole-3-methanol affects expression ISO Cpz (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of CPZ mRNA CTD PMID:21396975 CPZ Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of CPZ mRNA CTD PMID:28628672 CPZ Human L-methionine multiple interactions ISO Cpz (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPZ mRNA CTD PMID:20938992 CPZ Human malathion decreases expression EXP 6480464 Malathion results in decreased expression of CPZ mRNA CTD PMID:37047231 CPZ Human mercury atom increases expression EXP 6480464 Mercury results in increased expression of CPZ mRNA CTD PMID:16823088 CPZ Human mercury(0) increases expression EXP 6480464 Mercury results in increased expression of CPZ mRNA CTD PMID:16823088 CPZ Human methamphetamine increases expression ISO Cpz (Rattus norvegicus) 6480464 Methamphetamine results in increased expression of CPZ mRNA CTD PMID:15644446 CPZ Human methapyrilene increases methylation EXP 6480464 Methapyrilene results in increased methylation of CPZ intron CTD PMID:30157460 CPZ Human methimazole decreases expression ISO Cpz (Rattus norvegicus) 6480464 Methimazole results in decreased expression of CPZ mRNA CTD PMID:30047161 CPZ Human methoxychlor affects methylation ISO Cpz (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of CPZ gene CTD PMID:35440735 CPZ Human mifepristone increases expression EXP 6480464 Mifepristone results in increased expression of CPZ mRNA CTD PMID:17584828 CPZ Human Mono-carboxy isooctyl phthalate affects expression EXP 6480464 mono(carboxy-isooctyl)phthalate affects the expression of CPZ mRNA CTD PMID:34478338 CPZ Human monosodium L-glutamate increases expression ISO Cpz (Rattus norvegicus) 6480464 Sodium Glutamate results in increased expression of CPZ mRNA CTD PMID:20928830 CPZ Human N-nitrosodiethylamine multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CPZ mRNA CTD PMID:18164116 CPZ Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of CPZ mRNA CTD PMID:38832940 CPZ Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CPZ mRNA CTD PMID:22230336 CPZ Human paracetamol decreases expression ISO Cpz (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of CPZ mRNA CTD PMID:33387578 CPZ Human paraquat decreases expression ISO Cpz (Rattus norvegicus) 6480464 Paraquat results in decreased expression of CPZ mRNA CTD PMID:32680482 CPZ Human perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of CPZ mRNA CTD PMID:25812627 CPZ Human perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of CPZ mRNA CTD PMID:25812627 CPZ Human perfluorooctane-1-sulfonic acid multiple interactions ISO Cpz (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CPZ mRNA CTD PMID:36331819 CPZ Human perfluorooctanoic acid multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CPZ mRNA CTD PMID:35163327 CPZ Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CPZ mRNA CTD PMID:25812627 CPZ Human pioglitazone multiple interactions ISO Cpz (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of CPZ mRNA CTD PMID:27935865 CPZ Human progesterone multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of CPZ mRNA CTD PMID:17404688 CPZ Human progesterone increases expression ISO Cpz (Rattus norvegicus) 6480464 Progesterone results in increased expression of CPZ mRNA CTD PMID:20726854 CPZ Human sulfadimethoxine decreases expression ISO Cpz (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of CPZ mRNA CTD PMID:30047161 CPZ Human sulforaphane increases expression ISO Cpz (Mus musculus) 6480464 sulforaphane results in increased expression of CPZ mRNA CTD PMID:30529165 CPZ Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of CPZ mRNA CTD PMID:31533062 CPZ Human testosterone multiple interactions ISO Cpz (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CPZ mRNA CTD PMID:32741896 CPZ Human tetradecane decreases expression ISO Cpz (Rattus norvegicus) 6480464 n-tetradecane results in decreased expression of CPZ protein CTD PMID:17337753 CPZ Human titanium dioxide decreases methylation ISO Cpz (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CPZ promoter CTD PMID:35295148 CPZ Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of CPZ mRNA CTD PMID:30510588 CPZ Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of CPZ mRNA CTD PMID:25979313
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrylamide (ISO) Aflatoxin B2 alpha (EXP) alachlor (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (ISO) amitrole (ISO) ammonium chloride (ISO) antirheumatic drug (EXP) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (EXP) Benzo[ghi]perylene (ISO) Benzo[k]fluoranthene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) calcitriol (EXP) carbon nanotube (ISO) choline (ISO) clotrimazole (ISO) Cuprizon (ISO) cytarabine (EXP) dexamethasone (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diiodine (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) flavonoids (ISO) folic acid (ISO) formaldehyde (EXP) fulvestrant (EXP) furan (ISO) gentamycin (ISO) graphite (ISO) indole-3-methanol (ISO) indometacin (EXP) L-methionine (ISO) malathion (EXP) mercury atom (EXP) mercury(0) (EXP) methamphetamine (ISO) methapyrilene (EXP) methimazole (ISO) methoxychlor (ISO) mifepristone (EXP) Mono-carboxy isooctyl phthalate (EXP) monosodium L-glutamate (ISO) N-nitrosodiethylamine (ISO) okadaic acid (EXP) paracetamol (EXP,ISO) paraquat (ISO) perfluorohexanesulfonic acid (EXP) perfluorononanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) pioglitazone (ISO) progesterone (EXP,ISO) sulfadimethoxine (ISO) sulforaphane (ISO) sunitinib (EXP) testosterone (ISO) tetradecane (ISO) titanium dioxide (ISO) triclosan (EXP) valproic acid (EXP)
CPZ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 8,592,765 - 8,619,752 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 8,592,660 - 8,619,759 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 8,594,492 - 8,621,479 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 8,645,335 - 8,672,388 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 8,712,592 - 8,739,547 NCBI Celera 4 8,487,239 - 8,514,366 (+) NCBI Celera Cytogenetic Map 4 p16.1 NCBI HuRef 4 8,513,792 - 8,540,980 (+) NCBI HuRef CHM1_1 4 8,592,625 - 8,619,813 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 8,572,626 - 8,599,700 (+) NCBI T2T-CHM13v2.0
Cpz Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 35,659,562 - 35,682,970 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 35,659,562 - 35,683,042 (-) Ensembl GRCm39 Ensembl GRCm38 5 35,502,218 - 35,525,626 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 35,502,218 - 35,525,698 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 35,844,867 - 35,868,275 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 35,819,196 - 35,842,396 (-) NCBI MGSCv36 mm8 Celera 5 32,977,576 - 33,000,943 (-) NCBI Celera Cytogenetic Map 5 B3 NCBI cM Map 5 18.16 NCBI
Cpz Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 79,448,242 - 79,471,557 (+) NCBI GRCr8 mRatBN7.2 14 75,223,692 - 75,246,946 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 75,223,605 - 75,246,945 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 79,677,279 - 79,700,523 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 80,918,147 - 80,941,395 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 77,363,131 - 77,386,387 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 80,402,946 - 80,426,203 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 80,403,001 - 80,426,245 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 80,028,890 - 80,052,296 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 80,857,371 - 80,880,592 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 80,859,761 - 80,882,982 (+) NCBI Celera 14 74,152,116 - 74,175,339 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
Cpz Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955514 2,572,173 - 2,586,038 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955514 2,572,075 - 2,590,274 (-) NCBI ChiLan1.0 ChiLan1.0
CPZ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 8,878,662 - 8,907,200 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 8,806,093 - 8,835,503 (+) NCBI NHGRI_mPanPan1 PanPan1.1 4 8,623,879 - 8,684,722 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 8,656,029 - 8,684,722 (+) Ensembl panpan1.1 panPan2
CPZ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 60,291,704 - 60,312,551 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 60,297,752 - 60,312,598 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 62,942,106 - 62,964,158 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 60,767,264 - 60,789,341 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 60,772,327 - 60,789,341 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 60,261,876 - 60,283,927 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 60,466,687 - 60,488,752 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 60,822,705 - 60,844,819 (+) NCBI UU_Cfam_GSD_1.0
Cpz Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 66,100,353 - 66,123,380 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936477 19,801,698 - 19,825,256 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936477 19,792,738 - 19,825,066 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CPZ
CPZ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 44,516,632 - 44,546,475 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 44,516,800 - 44,546,337 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 842,345 - 872,472 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cpz
.
Predicted Target Of
Count of predictions: 4164 Count of miRNA genes: 947 Interacting mature miRNAs: 1158 Transcripts: ENST00000315782, ENST00000360986, ENST00000382480, ENST00000429646, ENST00000504070, ENST00000506287, ENST00000513486, ENST00000514602, ENST00000514875, ENST00000515606 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597228442 GWAS1324516_H appendicular lean mass QTL GWAS1324516 (human) 3e-12 appendicular lean mass 4 8608121 8608122 Human 597391096 GWAS1487170_H body fat distribution QTL GWAS1487170 (human) 0.0000002 body fat distribution body fat morphological measurement (CMO:0000089) 4 8601071 8601072 Human 597437183 GWAS1533257_H neuroblastoma QTL GWAS1533257 (human) 1e-12 neuroblastoma 4 8611299 8611300 Human 597455227 GWAS1551301_H size QTL GWAS1551301 (human) 2e-10 size 4 8603611 8603612 Human 597389746 GWAS1485820_H body fat distribution QTL GWAS1485820 (human) 0.0000008 body fat distribution body fat morphological measurement (CMO:0000089) 4 8601071 8601072 Human 597394738 GWAS1490812_H body fat distribution QTL GWAS1490812 (human) 0.0000001 body fat distribution body fat morphological measurement (CMO:0000089) 4 8601071 8601072 Human 597394384 GWAS1490458_H body fat distribution QTL GWAS1490458 (human) 5e-12 body fat distribution body fat morphological measurement (CMO:0000089) 4 8601071 8601072 Human 597607987 GWAS1664847_H body weight QTL GWAS1664847 (human) 2e-12 body mass (VT:0001259) body weight (CMO:0000012) 4 8596971 8596972 Human 596977595 GWAS1097114_H body height QTL GWAS1097114 (human) 2e-44 body height 4 8596971 8596972 Human 597394378 GWAS1490452_H body fat distribution QTL GWAS1490452 (human) 4e-13 body fat distribution body fat morphological measurement (CMO:0000089) 4 8601071 8601072 Human 596952486 GWAS1072005_H size QTL GWAS1072005 (human) 2e-10 size 4 8603611 8603612 Human 597045093 GWAS1141167_H Abnormality of refraction QTL GWAS1141167 (human) 2e-08 Abnormality of refraction 4 8600498 8600499 Human 597434122 GWAS1530196_H protein measurement QTL GWAS1530196 (human) 2e-68 protein measurement 4 8599865 8599866 Human
SHGC-59629
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 8,621,287 - 8,621,466 UniSTS GRCh37 Build 36 4 8,672,187 - 8,672,366 RGD NCBI36 Celera 4 8,514,165 - 8,514,344 RGD Cytogenetic Map 4 p16.1 UniSTS HuRef 4 8,540,779 - 8,540,958 UniSTS GeneMap99-GB4 RH Map 4 55.78 UniSTS
SHGC-142877
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 8,612,114 - 8,612,392 UniSTS GRCh37 Build 36 4 8,663,014 - 8,663,292 RGD NCBI36 Celera 4 8,504,995 - 8,505,273 RGD Cytogenetic Map 4 p16.1 UniSTS HuRef 4 8,531,609 - 8,531,887 UniSTS TNG Radiation Hybrid Map 4 5323.0 UniSTS
stb301J.ca1b
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 8,612,638 - 8,612,878 UniSTS GRCh37 Build 36 4 8,663,538 - 8,663,778 RGD NCBI36 Celera 4 8,505,519 - 8,505,759 RGD HuRef 4 8,532,133 - 8,532,373 UniSTS
stb301J10.p2
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 8,607,013 - 8,607,230 UniSTS GRCh37 Build 36 4 8,657,913 - 8,658,130 RGD NCBI36 Celera 4 8,499,811 - 8,500,044 RGD HuRef 4 8,526,418 - 8,526,651 UniSTS
G65151
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 8,607,999 - 8,608,226 UniSTS GRCh37 Build 36 4 8,658,899 - 8,659,126 RGD NCBI36 Celera 4 8,500,813 - 8,501,040 RGD Cytogenetic Map 4 p16.1 UniSTS HuRef 4 8,527,420 - 8,527,647 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1157
2145
1956
1610
3458
1475
2016
6
408
546
264
2076
4157
4323
21
2366
1
663
1670
1490
156
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000315782 ⟹ ENSP00000315074
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,756 - 8,619,749 (+) Ensembl
Ensembl Acc Id:
ENST00000360986 ⟹ ENSP00000354255
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,765 - 8,619,752 (+) Ensembl
Ensembl Acc Id:
ENST00000382480 ⟹ ENSP00000371920
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,660 - 8,619,759 (+) Ensembl
Ensembl Acc Id:
ENST00000504070
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,797 - 8,601,450 (+) Ensembl
Ensembl Acc Id:
ENST00000506287
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,708 - 8,601,498 (+) Ensembl
Ensembl Acc Id:
ENST00000513486
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,618,092 - 8,619,487 (+) Ensembl
Ensembl Acc Id:
ENST00000514602
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,782 - 8,601,508 (+) Ensembl
Ensembl Acc Id:
ENST00000514875
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,834 - 8,599,961 (+) Ensembl
Ensembl Acc Id:
ENST00000515606 ⟹ ENSP00000422693
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 8,592,726 - 8,619,751 (+) Ensembl
RefSeq Acc Id:
NM_001014447 ⟹ NP_001014447
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 8,592,765 - 8,619,752 (+) NCBI GRCh37 4 8,594,387 - 8,621,488 (+) ENTREZGENE Build 36 4 8,645,335 - 8,672,388 (+) NCBI Archive Celera 4 8,487,239 - 8,514,366 (+) RGD HuRef 4 8,513,792 - 8,540,980 (+) ENTREZGENE CHM1_1 4 8,592,625 - 8,619,813 (+) NCBI T2T-CHM13v2.0 4 8,572,626 - 8,599,700 (+) NCBI
Sequence:
AGAGCCCCGGCCCCGCGCGGCCCGAGTGCCACATCACTGCGCTGGCCGTCCAAGGTCCGCCGCCCCACCATGCCGCCCCCGCTGCCGCTGCTGCTCCTTACAGTCCTGGTCGTCGCCGCTGCCCGGCC
hide sequence
RefSeq Acc Id:
NM_001014448 ⟹ NP_001014448
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 8,592,765 - 8,619,752 (+) NCBI GRCh37 4 8,594,387 - 8,621,488 (+) ENTREZGENE Build 36 4 8,645,335 - 8,672,388 (+) NCBI Archive Celera 4 8,487,239 - 8,514,366 (+) RGD HuRef 4 8,513,792 - 8,540,980 (+) ENTREZGENE CHM1_1 4 8,592,625 - 8,619,813 (+) NCBI T2T-CHM13v2.0 4 8,572,626 - 8,599,700 (+) NCBI
Sequence:
AGAGCCCCGGCCCCGCGCGGCCCGAGTGCCACATCACTGCGCTGGCCGTCCAAGGTCCGCCGCCCCACCATGCCGCCCCCGCTGCCGCTGCTGCTCCTTACAGTCCTGGTCGTCGCCGCTGCCCGGCC
hide sequence
RefSeq Acc Id:
NM_003652 ⟹ NP_003643
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 8,592,765 - 8,619,752 (+) NCBI GRCh37 4 8,594,387 - 8,621,488 (+) ENTREZGENE Build 36 4 8,645,335 - 8,672,388 (+) NCBI Archive Celera 4 8,487,239 - 8,514,366 (+) RGD HuRef 4 8,513,792 - 8,540,980 (+) ENTREZGENE CHM1_1 4 8,592,625 - 8,619,813 (+) NCBI T2T-CHM13v2.0 4 8,572,626 - 8,599,700 (+) NCBI
Sequence:
AGAGCCCCGGCCCCGCGCGGCCCGAGTGCCACATCACTGCGCTGGCCGTCCAAGGTCCGCCGCCCCACCATGCCGCCCCCGCTGCCGCTGCTGCTCCTTACAGTCCTGGTCGTCGCCGCTGCCCGGCC
hide sequence
RefSeq Acc Id:
NP_003643 ⟸ NM_003652
- Peptide Label:
isoform 2 precursor
- UniProtKB:
A0A384MDV6 (UniProtKB/TrEMBL)
- Sequence:
MPPPPPLLLLTVLVVAAARPGCEFERNPAATCVDLQLRTCSDAAYNHTTFPNLLQHRSWEVVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCRHICEGLREVCQPAFDAIDMA
hide sequence
RefSeq Acc Id:
NP_001014447 ⟸ NM_001014447
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q66K79 (UniProtKB/Swiss-Prot), O00520 (UniProtKB/Swiss-Prot), Q96MX2 (UniProtKB/Swiss-Prot), A0A384MDV6 (UniProtKB/TrEMBL)
- Sequence:
MPPPPPLLLLTVLVVAAARPGCEFERNPAGECHRPPAADSATCVDLQLRTCSDAAYNHTTFPNL
hide sequence
RefSeq Acc Id:
NP_001014448 ⟸ NM_001014448
- Peptide Label:
isoform 3
- Sequence:
MAWPYFLDCHRYFTREDEGCYDPLEKLRGGLEADEALPSGLPPTFIRFSHHSYAQMVRVLRRTASRCAHVARTYSIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREMLIYLAQYL
hide sequence
Ensembl Acc Id:
ENSP00000354255 ⟸ ENST00000360986
Ensembl Acc Id:
ENSP00000315074 ⟸ ENST00000315782
Ensembl Acc Id:
ENSP00000371920 ⟸ ENST00000382480
Ensembl Acc Id:
ENSP00000422693 ⟸ ENST00000515606
RGD ID: 6867022 Promoter ID: EPDNEW_H6676 Type: initiation region Name: CPZ_1 Description: carboxypeptidase Z SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H6677 EPDNEW_H6678 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 8,592,796 - 8,592,856 EPDNEW
RGD ID: 6867024 Promoter ID: EPDNEW_H6677 Type: multiple initiation site Name: CPZ_3 Description: carboxypeptidase Z SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H6676 EPDNEW_H6678 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 8,600,952 - 8,601,012 EPDNEW
RGD ID: 6867026 Promoter ID: EPDNEW_H6678 Type: multiple initiation site Name: CPZ_2 Description: carboxypeptidase Z SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H6676 EPDNEW_H6677 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 8,619,506 - 8,619,566 EPDNEW
RGD ID: 6802193 Promoter ID: HG_KWN:47843 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, K562 Transcripts: ENST00000315782, ENST00000360986, NM_001014448 Position: Human Assembly Chr Position (strand) Source Build 36 4 8,645,201 - 8,645,701 (+) MPROMDB
RGD ID: 6802138 Promoter ID: HG_KWN:47844 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: UC003GLP.1 Position: Human Assembly Chr Position (strand) Source Build 36 4 8,653,291 - 8,654,042 (+) MPROMDB
