Symbol:
ALDOC
Name:
aldolase, fructose-bisphosphate C
RGD ID:
69125
HGNC Page
HGNC:418
Description:
Enables cytoskeletal protein binding activity and fructose-bisphosphate aldolase activity. Involved in epithelial cell differentiation and fructose 1,6-bisphosphate metabolic process. Located in extracellular exosome. Implicated in autoimmune disease of the nervous system.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ALDC; aldolase 3; aldolase c, fructose-biphosphate; aldolase C, fructose-bisphosphate; brain-type aldolase; fructoaldolase C; fructose-1,6-biphosphate triosephosphate lyase; fructose-bisphosphate aldolase C
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Aldoc (aldolase C, fructose-bisphosphate) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Aldoc (aldolase, fructose-bisphosphate C) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Aldoc (aldolase, fructose-bisphosphate C) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ALDOC (aldolase, fructose-bisphosphate C) NCBI
Ortholog
Canis lupus familiaris (dog):
ALDOC (aldolase, fructose-bisphosphate C) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Aldoc (aldolase, fructose-bisphosphate C) NCBI
Ortholog
Sus scrofa (pig):
ALDOC (aldolase, fructose-bisphosphate C) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ALDOC (aldolase, fructose-bisphosphate C) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Aldoc (aldolase, fructose-bisphosphate C) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Aldoa (aldolase A, fructose-bisphosphate) HGNC
OrthoMCL
Mus musculus (house mouse):
Aldoart1 (aldolase 1 A, retrogene 1) HGNC
OrthoMCL
Mus musculus (house mouse):
Aldoart2 (aldolase 1 A, retrogene 2) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Or9i14 (olfactory receptor family 9 subfamily I member 14) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Aldoc (aldolase, fructose-bisphosphate C)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Aldoc (aldolase C, fructose-bisphosphate)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aldoca (aldolase C, fructose-bisphosphate, a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
aldocb (aldolase C, fructose-bisphosphate, b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Ald
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aldo-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aldo-2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
aldoc.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
aldoc
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 28,573,120 - 28,576,895 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 28,573,115 - 28,576,948 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 26,900,138 - 26,903,913 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 23,924,260 - 23,928,078 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 23,924,265 - 23,927,989 NCBI Celera 17 23,759,160 - 23,762,978 (-) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 23,108,999 - 23,112,817 (-) NCBI HuRef CHM1_1 17 26,961,834 - 26,965,652 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 29,515,745 - 29,519,520 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ALDOC Human (+/-)-Aegeline multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human (-)-alpha-phellandrene increases expression EXP 6480464 alpha phellandrene results in increased expression of ALDOC mRNA CTD PMID:25075043 ALDOC Human (-)-epigallocatechin 3-gallate increases expression EXP 6480464 epigallocatechin gallate results in increased expression of ALDOC protein CTD PMID:31195006 ALDOC Human (1->4)-beta-D-glucan multiple interactions ISO RGD:10143 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ALDOA mRNA CTD PMID:36331819 ALDOC Human (RS)-coclaurine multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human (RS)-norcoclaurine multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human (S)-coclaurine multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human 1,10-phenanthroline increases expression EXP 6480464 1,10-phenanthroline results in increased expression of ALDOC mRNA CTD PMID:19502547 ALDOC Human 1,2-dimethylhydrazine decreases expression ISO RGD:10143 6480464 1,2-Dimethylhydrazine results in decreased expression of ALDOA mRNA; 1,2-Dimethylhydrazine results in decreased expression of ALDOC more ... CTD PMID:22206623 ALDOC Human 17alpha-ethynylestradiol decreases expression ISO RGD:2091 6480464 Ethinyl Estradiol results in decreased expression of ALDOC mRNA CTD PMID:12655037 ALDOC Human 17alpha-ethynylestradiol multiple interactions ISO RGD:10143 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ALDOA mRNA; [Tetrachlorodibenzodioxin co-treated with more ... CTD PMID:17942748 ALDOC Human 17alpha-ethynylestradiol increases expression ISO RGD:10143 6480464 Ethinyl Estradiol results in increased expression of ALDOA mRNA; Ethinyl Estradiol results in increased expression more ... CTD PMID:17942748|PMID:19400957 ALDOC Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ALDOC mRNA CTD PMID:20106945 ALDOC Human 17beta-estradiol decreases expression ISO RGD:2091 6480464 Estradiol results in decreased expression of ALDOC mRNA CTD PMID:32145629 ALDOC Human 17beta-estradiol decreases expression ISO RGD:10143 6480464 Estradiol results in decreased expression of ALDOA mRNA CTD PMID:19484750 ALDOC Human 17beta-estradiol increases expression ISO RGD:10143 6480464 Estradiol results in increased expression of ALDOA mRNA CTD PMID:15289156|PMID:39298647 ALDOC Human 1H-pyrazole decreases expression ISO RGD:10143 6480464 pyrazole results in decreased expression of ALDOC mRNA CTD PMID:17945193 ALDOC Human 1H-pyrazole increases expression ISO RGD:10143 6480464 pyrazole results in increased expression of ALDOA mRNA CTD PMID:17945193 ALDOC Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:10143 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of ALDOA mRNA CTD PMID:30294300 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10143 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ALDOA mRNA; [Tetrachlorodibenzodioxin co-treated with more ... CTD PMID:17942748|PMID:19654925 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:2091 6480464 Tetrachlorodibenzodioxin results in increased expression of ALDOC mRNA CTD PMID:32109520 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ALDOC mRNA CTD PMID:20106945|PMID:23152189 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:10143 6480464 Tetrachlorodibenzodioxin affects the expression of ALDOA mRNA; Tetrachlorodibenzodioxin affects the expression of ALDOC mRNA CTD PMID:21570461 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:10143 6480464 Tetrachlorodibenzodioxin results in decreased expression of ALDOA mRNA; Tetrachlorodibenzodioxin results in decreased expression of ALDOC more ... CTD PMID:15667827|PMID:19770486 ALDOC Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:10143 6480464 Tetrachlorodibenzodioxin results in increased expression of ALDOA mRNA; Tetrachlorodibenzodioxin results in increased expression of ALDOC more ... CTD PMID:16922920|PMID:19770486 ALDOC Human 2,4,6-tribromophenol decreases expression EXP 6480464 2,4,6-tribromophenol results in decreased expression of ALDOC mRNA CTD PMID:31675489 ALDOC Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:2091 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of ALDOC protein CTD PMID:19954255 ALDOC Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 ALDOC Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:2091 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of ALDOC mRNA CTD PMID:23196670 ALDOC Human 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:10143 6480464 tetrabromobisphenol A results in decreased expression of ALDOC mRNA CTD PMID:25172293 ALDOC Human 3,4-methylenedioxymethamphetamine increases expression ISO RGD:10143 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ALDOA mRNA CTD PMID:20188158 ALDOC Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 ALDOC Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 ALDOC Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of ALDOC protein CTD PMID:34186270 ALDOC Human 4,4'-sulfonyldiphenol increases expression ISO RGD:10143 6480464 bisphenol S results in increased expression of ALDOA mRNA CTD PMID:39298647 ALDOC Human 4-hydroxynon-2-enal multiple interactions ISO RGD:10143 6480464 Hydroxyurea promotes the reaction [4-hydroxy-2-nonenal binds to ALDOA protein] CTD PMID:20889679 ALDOC Human 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of ALDOC mRNA CTD PMID:16671099 ALDOC Human 4-hydroxyphenyl retinamide increases expression ISO RGD:10143 6480464 Fenretinide results in increased expression of ALDOC mRNA CTD PMID:28973697 ALDOC Human 5-aza-2'-deoxycytidine increases expression EXP 6480464 Decitabine results in increased expression of ALDOC mRNA CTD PMID:17908484 ALDOC Human 6-propyl-2-thiouracil decreases expression ISO RGD:2091 6480464 Propylthiouracil results in decreased expression of ALDOC mRNA CTD PMID:30047161 ALDOC Human aconitine increases expression ISO RGD:2091 6480464 Aconitine results in increased expression of ALDOC protein CTD PMID:33236894 ALDOC Human acrylamide affects expression ISO RGD:2091 6480464 Acrylamide affects the expression of ALDOC mRNA CTD PMID:28959563 ALDOC Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ALDOC mRNA CTD PMID:32763439 ALDOC Human aflatoxin B1 decreases expression ISO RGD:10143 6480464 Aflatoxin B1 results in decreased expression of ALDOC mRNA CTD PMID:19770486 ALDOC Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of ALDOC mRNA CTD PMID:27153756 ALDOC Human aldehydo-D-glucose multiple interactions ISO RGD:10143 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 ALDOC Human aldrin decreases expression ISO RGD:10143 6480464 Aldrin results in decreased expression of ALDOA mRNA CTD PMID:18579281 ALDOC Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ALDOC mRNA; Tretinoin results in increased expression of ALDOC more ... CTD PMID:15894607|PMID:33167477 ALDOC Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of ALDOC mRNA CTD PMID:23724009 ALDOC Human alpha-phellandrene increases expression EXP 6480464 alpha phellandrene results in increased expression of ALDOC mRNA CTD PMID:25075043 ALDOC Human ammonium chloride affects expression ISO RGD:2091 6480464 Ammonium Chloride affects the expression of ALDOC mRNA CTD PMID:16483693 ALDOC Human Archazolid B increases expression EXP 6480464 archazolid B results in increased expression of ALDOC mRNA CTD PMID:25218289 ALDOC Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of ALDOC mRNA CTD PMID:33212167 ALDOC Human Aroclor 1254 decreases expression ISO RGD:10143 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ALDOA mRNA CTD PMID:23650126 ALDOC Human arsenous acid multiple interactions EXP 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ALDOC protein] CTD PMID:26598702 ALDOC Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of ALDOC mRNA CTD PMID:15725085 ALDOC Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of ALDOC mRNA CTD PMID:22378314 ALDOC Human benzo[a]pyrene decreases expression ISO RGD:10143 6480464 Benzo(a)pyrene results in decreased expression of ALDOC mRNA CTD PMID:19770486 ALDOC Human benzo[a]pyrene affects expression ISO RGD:10143 6480464 Benzo(a)pyrene affects the expression of ALDOA mRNA CTD PMID:22342234 ALDOC Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of ALDOC promoter CTD PMID:27901495 ALDOC Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of ALDOC mRNA CTD PMID:19150397 ALDOC Human bexarotene increases expression ISO RGD:2091 6480464 bexarotene results in increased expression of ALDOC mRNA CTD PMID:16648578 ALDOC Human bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:10143 6480464 Diethylhexyl Phthalate results in decreased expression of ALDOC mRNA CTD PMID:34319233 ALDOC Human bis(2-ethylhexyl) phthalate increases expression ISO RGD:10143 6480464 Diethylhexyl Phthalate results in increased expression of ALDOA mRNA; Diethylhexyl Phthalate results in increased expression more ... CTD PMID:33754040|PMID:35716406 ALDOC Human bisphenol A affects expression ISO RGD:2091 6480464 bisphenol A affects the expression of ALDOC mRNA CTD PMID:25181051 ALDOC Human bisphenol A increases expression ISO RGD:10143 6480464 bisphenol A results in increased expression of ALDOC mRNA CTD PMID:32156529 ALDOC Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ALDOC protein CTD PMID:31675489 ALDOC Human bisphenol A decreases expression ISO RGD:2091 6480464 bisphenol A results in decreased expression of ALDOC mRNA CTD PMID:32145629 ALDOC Human bisphenol A decreases expression ISO RGD:10143 6480464 bisphenol A results in decreased expression of ALDOA protein CTD PMID:35999755 ALDOC Human bisphenol A increases methylation ISO RGD:10143 6480464 bisphenol A results in increased methylation of ALDOA promoter CTD PMID:27312807 ALDOC Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ALDOC mRNA CTD PMID:30903817 ALDOC Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ALDOC mRNA; bisphenol A results in increased expression more ... CTD PMID:29275510|PMID:34186270|PMID:37567409 ALDOC Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of ALDOC protein CTD PMID:34186270 ALDOC Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of ALDOC protein CTD PMID:34186270 ALDOC Human bisphenol F decreases expression ISO RGD:10143 6480464 bisphenol F results in decreased expression of ALDOA mRNA; bisphenol F results in decreased expression more ... CTD PMID:38685157 ALDOC Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of ALDOC protein CTD PMID:34186270 ALDOC Human bleomycin A2 multiple interactions ISO RGD:10143 6480464 [Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of ALDOC protein CTD PMID:29733421 ALDOC Human butan-1-ol multiple interactions EXP 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 ALDOC Human Butylbenzyl phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human cadmium dichloride increases expression ISO RGD:10143 6480464 Cadmium Chloride results in increased expression of ALDOC mRNA CTD PMID:29408670 ALDOC Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human caffeine multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of ALDOC protein CTD PMID:35688186 ALDOC Human cannabidiol increases expression ISO RGD:10143 6480464 Cannabidiol results in increased expression of ALDOA mRNA CTD PMID:31052254 ALDOC Human cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of ALDOC protein CTD PMID:34122009 ALDOC Human captan increases expression ISO RGD:10143 6480464 Captan results in increased expression of ALDOA mRNA; Captan results in increased expression of ALDOC more ... CTD PMID:31558096 ALDOC Human carbon nanotube increases expression ISO RGD:10143 6480464 Nanotubes, Carbon analog results in increased expression of ALDOC mRNA CTD PMID:25554681 ALDOC Human carbon nanotube affects expression ISO RGD:10143 6480464 Nanotubes, Carbon affects the expression of ALDOA protein CTD PMID:21135415 ALDOC Human carbon nanotube decreases expression ISO RGD:10143 6480464 Nanotubes, Carbon results in decreased expression of ALDOC mRNA CTD PMID:25620056 ALDOC Human celecoxib affects expression ISO RGD:10143 6480464 Celecoxib affects the expression of ALDOC mRNA CTD PMID:20562220 ALDOC Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ALDOC mRNA CTD PMID:24280081 ALDOC Human cisplatin affects expression ISO RGD:10143 6480464 Cisplatin affects the expression of ALDOA mRNA CTD PMID:21151649 ALDOC Human cisplatin multiple interactions ISO RGD:10143 6480464 [Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of ALDOC protein CTD PMID:29733421 ALDOC Human cisplatin multiple interactions EXP 6480464 Cisplatin promotes the reaction [jinfukang results in increased expression of ALDOC mRNA]; jinfukang promotes the more ... CTD PMID:27392435 ALDOC Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ALDOC mRNA CTD PMID:27594783 ALDOC Human cisplatin decreases expression ISO RGD:10143 6480464 Cisplatin results in decreased expression of ALDOC mRNA CTD PMID:24280081 ALDOC Human clozapine decreases expression ISO RGD:10143 6480464 Clozapine results in decreased expression of ALDOC mRNA CTD PMID:16465460 ALDOC Human clozapine increases expression ISO RGD:2091 6480464 Clozapine results in increased expression of ALDOC mRNA CTD PMID:15860345 ALDOC Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ALDOC mRNA CTD PMID:22202117|PMID:24486526 ALDOC Human cobalt dichloride multiple interactions EXP 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of ALDOC mRNA] CTD PMID:22202117 ALDOC Human copper(II) chloride decreases expression ISO RGD:10143 6480464 cupric chloride results in decreased expression of ALDOC protein CTD PMID:29617964 ALDOC Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human copper(II) chloride increases expression ISO RGD:10143 6480464 cupric chloride results in increased expression of ALDOA protein CTD PMID:29617964 ALDOC Human CU-O LINKAGE decreases expression EXP 6480464 cupric oxide results in decreased expression of ALDOC protein CTD PMID:25470785 ALDOC Human curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of ALDOC mRNA CTD PMID:17198877 ALDOC Human cyclosporin A decreases expression ISO RGD:10143 6480464 Cyclosporine results in decreased expression of ALDOC mRNA CTD PMID:19770486 ALDOC Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of ALDOC mRNA CTD PMID:20106945|PMID:21632981|PMID:25562108 ALDOC Human D-glucose multiple interactions ISO RGD:10143 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 ALDOC Human decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of ALDOC protein CTD PMID:31675489 ALDOC Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 ALDOC Human dexamethasone decreases expression ISO RGD:10143 6480464 Dexamethasone results in decreased expression of ALDOA protein CTD PMID:33567340 ALDOC Human dextran sulfate decreases expression ISO RGD:10143 6480464 Dextran Sulfate results in decreased expression of ALDOA protein; Dextran Sulfate results in decreased expression more ... CTD PMID:35093514|PMID:35999755 ALDOC Human dextran sulfate increases expression ISO RGD:10143 6480464 Dextran Sulfate results in increased expression of ALDOC protein CTD PMID:35362542 ALDOC Human dextran sulfate multiple interactions ISO RGD:10143 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of ALDOC protein] CTD PMID:35362542 ALDOC Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of ALDOC mRNA CTD PMID:15725085 ALDOC Human diarsenic trioxide multiple interactions EXP 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ALDOC protein] CTD PMID:26598702 ALDOC Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ALDOC mRNA CTD PMID:37042841 ALDOC Human dibutyl phthalate decreases expression ISO RGD:2091 6480464 Dibutyl Phthalate results in decreased expression of ALDOC mRNA CTD PMID:21266533 ALDOC Human dibutyl phthalate decreases expression ISO RGD:10143 6480464 Dibutyl Phthalate results in decreased expression of ALDOA mRNA CTD PMID:21266533 ALDOC Human dibutyl phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human dichlorine multiple interactions ISO RGD:2091 6480464 [Ozone co-treated with Chlorine] results in increased expression of ALDOC mRNA CTD PMID:18636392 ALDOC Human diclofenac increases expression ISO RGD:2091 6480464 Diclofenac results in increased expression of ALDOC mRNA CTD PMID:30723492 ALDOC Human diethyl phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human diethyl phthalate decreases expression ISO RGD:2091 6480464 diethyl phthalate results in decreased expression of ALDOC mRNA CTD PMID:32341500 ALDOC Human diethylstilbestrol increases expression ISO RGD:10143 6480464 Diethylstilbestrol results in increased expression of ALDOA mRNA CTD PMID:15289156 ALDOC Human diisobutyl phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human diisononyl phthalate multiple interactions ISO RGD:2091 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated more ... CTD PMID:31199487|PMID:37690569 ALDOC Human dimethylarsinic acid multiple interactions ISO RGD:10143 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 ALDOC Human dinophysistoxin 1 increases expression EXP 6480464 dinophysistoxin 1 results in increased expression of ALDOC mRNA CTD PMID:28939011 ALDOC Human dioxygen affects expression ISO RGD:10143 6480464 Oxygen deficiency affects the expression of ALDOC mRNA CTD PMID:17193925 ALDOC Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of ALDOC mRNA CTD PMID:19502547|PMID:20042640|PMID:24236059|PMID:26516004 ALDOC Human dioxygen increases expression ISO RGD:10143 6480464 Oxygen deficiency results in increased expression of ALDOA mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:20880076 ALDOC Human dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression EXP 6480464 Antimony Potassium Tartrate results in increased expression of ALDOC mRNA CTD PMID:28713220 ALDOC Human dizocilpine maleate increases expression ISO RGD:2091 6480464 Dizocilpine Maleate results in increased expression of ALDOC protein CTD PMID:21297352 ALDOC Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 ALDOC Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ALDOC mRNA CTD PMID:30031762 ALDOC Human doxorubicin multiple interactions ISO RGD:10143 6480464 [Docetaxel co-treated with Doxorubicin] results in decreased expression of ALDOA protein CTD PMID:20457137 ALDOC Human doxorubicin affects expression EXP 6480464 Doxorubicin affects the expression of ALDOC mRNA CTD PMID:29803840 ALDOC Human endosulfan decreases expression ISO RGD:2091 6480464 Endosulfan results in decreased expression of ALDOC mRNA CTD PMID:29391264 ALDOC Human epoxiconazole decreases expression ISO RGD:10143 6480464 epoxiconazole results in decreased expression of ALDOA mRNA CTD PMID:35436446 ALDOC Human ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ALDOC mRNA CTD PMID:23378141 ALDOC Human ethanol affects splicing ISO RGD:10143 6480464 Ethanol affects the splicing of ALDOA mRNA CTD PMID:30319688 ALDOC Human ethanol increases expression ISO RGD:10143 6480464 Ethanol results in increased expression of ALDOA mRNA; Ethanol results in increased expression of ALDOC more ... CTD PMID:15513904|PMID:30319688 ALDOC Human ethanol multiple interactions ISO RGD:10143 6480464 Ethanol affects the expression of and affects the splicing of ALDOC mRNA CTD PMID:30319688 ALDOC Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of ALDOC mRNA CTD PMID:23649840 ALDOC Human etoposide affects response to substance EXP 6480464 ALDOC protein affects the susceptibility to Etoposide CTD PMID:16217747 ALDOC Human etoposide multiple interactions ISO RGD:10143 6480464 [Etoposide co-treated with Cisplatin co-treated with Bleomycin] results in decreased expression of ALDOC protein CTD PMID:29733421 ALDOC Human Evodiamine multiple interactions ISO RGD:10143 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of ALDOC protein] CTD PMID:35362542 ALDOC Human fenthion increases expression ISO RGD:10143 6480464 Fenthion results in increased expression of ALDOC mRNA CTD PMID:34813904 ALDOC Human flavonoids increases expression ISO RGD:2091 6480464 Flavonoids results in increased expression of ALDOC mRNA CTD PMID:18035473 ALDOC Human fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of ALDOC mRNA CTD PMID:37386098 ALDOC Human flutamide increases expression ISO RGD:2091 6480464 Flutamide results in increased expression of ALDOC mRNA CTD PMID:21525395 ALDOC Human flutamide increases expression ISO RGD:10143 6480464 Flutamide results in increased expression of ALDOA mRNA CTD PMID:17702527 ALDOC Human folpet increases expression ISO RGD:10143 6480464 folpet results in increased expression of ALDOA mRNA; folpet results in increased expression of ALDOC more ... CTD PMID:31558096 ALDOC Human fructose multiple interactions ISO RGD:10143 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 ALDOC Human fumonisin B1 increases expression ISO RGD:10143 6480464 fumonisin B1 results in increased expression of ALDOA mRNA CTD PMID:16221962 ALDOC Human furan increases expression ISO RGD:2091 6480464 furan results in increased expression of ALDOC mRNA CTD PMID:25539665 ALDOC Human furfural multiple interactions EXP 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 ALDOC Human genistein multiple interactions ISO RGD:2091 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ALDOC mRNA CTD PMID:21782745 ALDOC Human genistein decreases expression ISO RGD:10143 6480464 Genistein results in decreased expression of ALDOC mRNA CTD PMID:32186404 ALDOC Human genistein increases expression ISO RGD:10143 6480464 Genistein results in increased expression of ALDOA mRNA CTD PMID:15289156 ALDOC Human glucose multiple interactions ISO RGD:10143 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 ALDOC Human GSK-J4 increases expression EXP 6480464 GSK-J4 results in increased expression of ALDOC mRNA CTD PMID:29301935 ALDOC Human haloperidol increases expression ISO RGD:2091 6480464 Haloperidol results in increased expression of ALDOC mRNA CTD PMID:15860345 ALDOC Human herbicide multiple interactions ISO RGD:10143 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 ALDOC Human hydroxyurea multiple interactions ISO RGD:10143 6480464 Hydroxyurea promotes the reaction [4-hydroxy-2-nonenal binds to ALDOA protein] CTD PMID:20889679 ALDOC Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 ALDOC Human iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of ALDOC mRNA CTD PMID:20368581 ALDOC Human iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of ALDOC mRNA CTD PMID:20368581 ALDOC Human isobutanol multiple interactions EXP 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ... CTD PMID:29432896 ALDOC Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of ALDOC protein CTD PMID:32959892 ALDOC Human ketamine increases expression ISO RGD:2091 6480464 Ketamine results in increased expression of ALDOC mRNA CTD PMID:20080153 ALDOC Human lead diacetate decreases expression ISO RGD:10143 6480464 lead acetate results in decreased expression of ALDOC protein CTD PMID:20797405 ALDOC Human lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human lead diacetate increases expression ISO RGD:10143 6480464 lead acetate results in increased expression of ALDOA protein CTD PMID:20797405 ALDOC Human Macrosphelide A affects binding EXP 6480464 macrosphelide A binds to ALDOC protein CTD PMID:34681284 ALDOC Human maneb multiple interactions ISO RGD:10143 6480464 [Paraquat co-treated with Maneb] results in decreased expression of ALDOC mRNA CTD PMID:18386188 ALDOC Human manganese(II) chloride decreases expression ISO RGD:2091 6480464 manganese chloride results in decreased expression of ALDOC mRNA CTD PMID:28801915 ALDOC Human methamphetamine multiple interactions ISO RGD:2091 6480464 2,3,4,5-Tetrahydro-7,8-dihydroxy-1-phenyl-1H-3-benzazepine inhibits the reaction [Methamphetamine affects the localization of ALDOC mRNA] CTD PMID:18299792 ALDOC Human methamphetamine increases expression ISO RGD:2091 6480464 Methamphetamine results in increased expression of ALDOC protein CTD PMID:19826936 ALDOC Human methamphetamine affects localization ISO RGD:2091 6480464 Methamphetamine affects the localization of ALDOC mRNA CTD PMID:18299792 ALDOC Human methidathion increases expression ISO RGD:10143 6480464 methidathion results in increased expression of ALDOC mRNA CTD PMID:34813904 ALDOC Human methimazole decreases expression ISO RGD:2091 6480464 Methimazole results in decreased expression of ALDOC mRNA CTD PMID:30047161 ALDOC Human methoxychlor multiple interactions ISO RGD:2091 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ALDOC mRNA CTD PMID:21782745 ALDOC Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of ALDOC mRNA CTD PMID:23649840 ALDOC Human methylarsonic acid multiple interactions ISO RGD:10143 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 ALDOC Human methylparaben decreases expression EXP 6480464 methylparaben results in decreased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of ALDOC mRNA CTD PMID:17584828 ALDOC Human N-methyl-4-phenylpyridinium decreases expression ISO RGD:2091 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ALDOC mRNA CTD PMID:28801915 ALDOC Human N-methyl-4-phenylpyridinium decreases expression ISO RGD:10143 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ALDOA mRNA CTD PMID:17475336 ALDOC Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of ALDOC mRNA CTD PMID:25583101 ALDOC Human nickel dichloride increases expression ISO RGD:10143 6480464 nickel chloride results in increased expression of ALDOA mRNA CTD PMID:12426141|PMID:12839937 ALDOC Human nickel dichloride multiple interactions ISO RGD:10143 6480464 HIF1A affects the reaction [nickel chloride results in increased expression of ALDOA mRNA] CTD PMID:12426141 ALDOC Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of ALDOC mRNA CTD PMID:17382205|PMID:22714537 ALDOC Human niclosamide decreases expression EXP 6480464 Niclosamide results in decreased expression of ALDOC mRNA CTD PMID:22576131 ALDOC Human niclosamide increases expression EXP 6480464 Niclosamide results in increased expression of ALDOC mRNA CTD PMID:36318118 ALDOC Human nitrates multiple interactions ISO RGD:10143 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ALDOA more ... CTD PMID:35964746 ALDOC Human NMN zwitterion multiple interactions ISO RGD:10143 6480464 Nicotinamide Mononucleotide inhibits the reaction [Zearalenone results in decreased expression of ALDOA protein] CTD PMID:38159578 ALDOC Human obeticholic acid increases expression EXP 6480464 obeticholic acid results in increased expression of ALDOC mRNA CTD PMID:27939613 ALDOC Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of ALDOC mRNA CTD PMID:38832940 ALDOC Human oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of ALDOC mRNA CTD PMID:17762391 ALDOC Human ozone multiple interactions ISO RGD:2091 6480464 [Ozone co-treated with Chlorine] results in increased expression of ALDOC mRNA CTD PMID:18636392 ALDOC Human ozone multiple interactions ISO RGD:10143 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 ALDOC Human p-chloromercuribenzoic acid decreases expression EXP 6480464 p-Chloromercuribenzoic Acid results in decreased expression of ALDOC mRNA CTD PMID:26272509 ALDOC Human p-chloromercuribenzoic acid multiple interactions EXP 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 ALDOC Human paracetamol affects expression ISO RGD:10143 6480464 Acetaminophen affects the expression of ALDOA mRNA; Acetaminophen affects the expression of ALDOC mRNA CTD PMID:17562736 ALDOC Human paracetamol affects expression ISO RGD:2091 6480464 Acetaminophen affects the expression of ALDOC mRNA CTD PMID:33387578 ALDOC Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ALDOC mRNA CTD PMID:29067470 ALDOC Human paraquat multiple interactions ISO RGD:10143 6480464 [Paraquat co-treated with Maneb] results in decreased expression of ALDOC mRNA CTD PMID:18386188 ALDOC Human paraquat decreases expression ISO RGD:2091 6480464 Paraquat results in decreased expression of ALDOC mRNA CTD PMID:32680482 ALDOC Human PCB138 decreases expression ISO RGD:2091 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of ALDOC mRNA CTD PMID:23829299 ALDOC Human pentachlorophenol increases expression ISO RGD:10143 6480464 Pentachlorophenol results in increased expression of ALDOA mRNA CTD PMID:23892564 ALDOC Human perfluorobutyric acid increases expression ISO RGD:10143 6480464 perfluorobutyric acid results in increased expression of ALDOA mRNA CTD PMID:34474067 ALDOC Human perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of ALDOC mRNA CTD PMID:32588087 ALDOC Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10143 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ALDOA mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 ALDOC Human perfluorooctanoic acid increases expression ISO RGD:10143 6480464 perfluorooctanoic acid results in increased expression of ALDOC protein CTD PMID:37422089 ALDOC Human Pf-06840003 multiple interactions ISO RGD:10143 6480464 PF-06840003 inhibits the reaction [[amyloid beta-protein (1-42) binds to MAPT protein] which results in decreased more ... CTD PMID:39172838 ALDOC Human phenobarbital affects expression ISO RGD:10143 6480464 Phenobarbital affects the expression of ALDOA mRNA CTD PMID:23091169 ALDOC Human phenylmercury acetate decreases expression EXP 6480464 Phenylmercuric Acetate results in decreased expression of ALDOC mRNA CTD PMID:26272509 ALDOC Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 ALDOC Human phenylpropanolamine decreases expression ISO RGD:10143 6480464 Phenylpropanolamine results in decreased expression of ALDOA mRNA CTD PMID:16465460 ALDOC Human picoxystrobin increases expression EXP 6480464 picoxystrobin results in increased expression of ALDOC mRNA CTD PMID:33512557 ALDOC Human pirinixic acid increases expression ISO RGD:10143 6480464 pirinixic acid results in increased expression of ALDOA mRNA; pirinixic acid results in increased expression more ... CTD PMID:16221962|PMID:17426115|PMID:18301758 ALDOC Human potassium chromate increases expression EXP 6480464 potassium chromate(VI) results in increased expression of ALDOC mRNA CTD PMID:22714537 ALDOC Human pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:2091 6480464 Pregnenolone Carbonitrile results in decreased expression of ALDOC mRNA CTD PMID:30047161 ALDOC Human progesterone decreases expression ISO RGD:10143 6480464 Progesterone results in decreased expression of ALDOC mRNA CTD PMID:22238285 ALDOC Human propiconazole increases expression ISO RGD:10143 6480464 propiconazole results in increased expression of ALDOA mRNA CTD PMID:21278054 ALDOC Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of ALDOC mRNA CTD PMID:21632981 ALDOC Human resveratrol increases expression EXP 6480464 resveratrol results in increased expression of ALDOC mRNA CTD PMID:15582268 ALDOC Human resveratrol decreases expression ISO RGD:10143 6480464 Resveratrol results in decreased expression of ALDOA protein CTD PMID:25505154 ALDOC Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of ALDOC mRNA CTD PMID:29955902 ALDOC Human rotenone increases expression ISO RGD:2091 6480464 Rotenone results in increased expression of ALDOC protein CTD PMID:35544339 ALDOC Human S-nitrosoglutathione increases expression EXP 6480464 S-Nitrosoglutathione results in increased expression of ALDOC mRNA CTD PMID:38825487 ALDOC Human sarin affects expression ISO RGD:2091 6480464 Sarin affects the expression of ALDOC protein CTD PMID:28973502 ALDOC Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of ALDOC more ... CTD PMID:27188386|PMID:37664457 ALDOC Human silicon dioxide affects expression EXP 6480464 Silicon Dioxide analog affects the expression of ALDOC mRNA CTD PMID:25895662 ALDOC Human silver atom decreases expression ISO RGD:10143 6480464 Silver results in decreased expression of ALDOC mRNA CTD PMID:27131904 ALDOC Human silver(0) decreases expression ISO RGD:10143 6480464 Silver results in decreased expression of ALDOC mRNA CTD PMID:27131904 ALDOC Human SKF 38393 multiple interactions ISO RGD:2091 6480464 2,3,4,5-Tetrahydro-7,8-dihydroxy-1-phenyl-1H-3-benzazepine inhibits the reaction [Methamphetamine affects the localization of ALDOC mRNA] CTD PMID:18299792 ALDOC Human sodium arsenate multiple interactions ISO RGD:10143 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 ALDOC Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ALDOC mRNA CTD PMID:23648393|PMID:28713220|PMID:34032870 ALDOC Human sodium arsenite multiple interactions ISO RGD:10143 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 ALDOC Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human sodium arsenite decreases expression ISO RGD:2091 6480464 sodium arsenite results in decreased expression of ALDOC protein CTD PMID:29459688 ALDOC Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of ALDOC protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 ALDOC Human sodium dichromate increases expression ISO RGD:10143 6480464 sodium bichromate results in increased expression of ALDOA mRNA; sodium bichromate results in increased expression more ... CTD PMID:31558096 ALDOC Human sodium fluoride decreases expression ISO RGD:10143 6480464 Sodium Fluoride results in decreased expression of ALDOA mRNA CTD PMID:21340527 ALDOC Human Soman decreases expression ISO RGD:2091 6480464 Soman results in decreased expression of ALDOC mRNA CTD PMID:19281266 ALDOC Human sotorasib multiple interactions EXP 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of ALDOC mRNA CTD PMID:36139627 ALDOC Human sulindac sulfide decreases expression EXP 6480464 sulindac sulfide results in decreased expression of ALDOC mRNA CTD PMID:16184548 ALDOC Human T-2 toxin decreases expression ISO RGD:2091 6480464 T-2 Toxin results in decreased expression of ALDOC mRNA CTD PMID:26141394 ALDOC Human tamoxifen increases expression ISO RGD:10143 6480464 Tamoxifen results in increased expression of ALDOA mRNA CTD PMID:19400957 ALDOC Human tapentadol increases expression EXP 6480464 tapentadol results in increased expression of ALDOC mRNA CTD PMID:27317026 ALDOC Human tert-butyl hydroperoxide increases expression ISO RGD:10143 6480464 tert-Butylhydroperoxide results in increased expression of ALDOA mRNA CTD PMID:15003993 ALDOC Human testosterone increases expression ISO RGD:10143 6480464 Testosterone deficiency results in increased expression of ALDOC mRNA CTD PMID:33848595 ALDOC Human testosterone multiple interactions ISO RGD:10143 6480464 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane inhibits the reaction [Testosterone deficiency results in increased expression of ALDOC mRNA] CTD PMID:33848595 ALDOC Human tetrachloromethane increases expression ISO RGD:10143 6480464 Carbon Tetrachloride results in increased expression of ALDOA mRNA CTD PMID:31919559 ALDOC Human tetrachloromethane decreases expression ISO RGD:10143 6480464 Carbon Tetrachloride results in decreased expression of ALDOC mRNA CTD PMID:31919559 ALDOC Human thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ALDOC mRNA CTD PMID:22378314 ALDOC Human theophylline decreases expression EXP 6480464 Theophylline results in decreased expression of ALDOC mRNA CTD PMID:16083514 ALDOC Human thimerosal decreases expression EXP 6480464 Thimerosal results in decreased expression of ALDOC mRNA CTD PMID:27188386 ALDOC Human thioacetamide increases expression ISO RGD:2091 6480464 Thioacetamide results in increased expression of ALDOC mRNA CTD PMID:23411599 ALDOC Human thiram increases expression EXP 6480464 Thiram results in increased expression of ALDOC mRNA CTD PMID:38568856 ALDOC Human titanium dioxide increases methylation ISO RGD:10143 6480464 titanium dioxide results in increased methylation of ALDOA gene CTD PMID:35295148 ALDOC Human trametinib multiple interactions EXP 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of ALDOC mRNA CTD PMID:36139627 ALDOC Human triclosan decreases expression EXP 6480464 Triclosan results in decreased expression of ALDOC mRNA CTD PMID:30510588 ALDOC Human trimellitic anhydride increases expression ISO RGD:10143 6480464 trimellitic anhydride results in increased expression of ALDOC mRNA CTD PMID:19042947 ALDOC Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ALDOC mRNA CTD PMID:37042841 ALDOC Human Triptolide decreases expression ISO RGD:10143 6480464 triptolide results in decreased expression of ALDOC mRNA CTD PMID:32835833 ALDOC Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of ALDOC mRNA CTD PMID:22378314 ALDOC Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of ALDOC mRNA CTD PMID:29453283 ALDOC Human valproic acid affects expression ISO RGD:10143 6480464 Valproic Acid affects the expression of ALDOA mRNA; Valproic Acid affects the expression of ALDOC more ... CTD PMID:17963808 ALDOC Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ALDOC mRNA CTD PMID:25979313 ALDOC Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of ALDOC mRNA CTD PMID:23179753 ALDOC Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of ALDOC gene CTD PMID:29154799 ALDOC Human vancomycin increases expression ISO RGD:10143 6480464 Vancomycin results in increased expression of ALDOC mRNA CTD PMID:18930951 ALDOC Human vincristine decreases expression EXP 6480464 Vincristine results in decreased expression of ALDOC mRNA CTD PMID:23649840 ALDOC Human vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of ALDOC mRNA CTD PMID:27188386 ALDOC Human Yessotoxin increases expression EXP 6480464 yessotoxin analog results in increased expression of ALDOC mRNA CTD PMID:30679557 ALDOC Human yohimbine multiple interactions ISO RGD:10143 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with more ... CTD PMID:28843594 ALDOC Human zearalenone decreases expression ISO RGD:10143 6480464 Zearalenone results in decreased expression of ALDOA protein; Zearalenone results in decreased expression of ALDOC more ... CTD PMID:25058043|PMID:38159578 ALDOC Human zearalenone multiple interactions ISO RGD:10143 6480464 Nicotinamide Mononucleotide inhibits the reaction [Zearalenone results in decreased expression of ALDOA protein] CTD PMID:38159578 ALDOC Human zinc dichloride multiple interactions EXP 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of ALDOC mRNA] CTD PMID:22202117
Imported Annotations - KEGG (archival)
(+/-)-Aegeline (ISO) (-)-alpha-phellandrene (EXP) (-)-epigallocatechin 3-gallate (EXP) (1->4)-beta-D-glucan (ISO) (RS)-coclaurine (ISO) (RS)-norcoclaurine (ISO) (S)-coclaurine (ISO) 1,10-phenanthroline (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (EXP,ISO) 5-aza-2'-deoxycytidine (EXP) 6-propyl-2-thiouracil (ISO) aconitine (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) aldrin (ISO) all-trans-retinoic acid (EXP) alpha-phellandrene (EXP) ammonium chloride (ISO) Archazolid B (EXP) aristolochic acid A (EXP) Aroclor 1254 (ISO) arsenous acid (EXP) atrazine (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) bexarotene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (EXP,ISO) bleomycin A2 (ISO) butan-1-ol (EXP) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP,ISO) caffeine (EXP,ISO) cannabidiol (EXP,ISO) captan (ISO) carbon nanotube (ISO) celecoxib (ISO) cisplatin (EXP,ISO) clozapine (ISO) cobalt dichloride (EXP) copper(II) chloride (EXP,ISO) CU-O LINKAGE (EXP) curcumin (EXP) cyclosporin A (EXP,ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (EXP) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dichlorine (ISO) diclofenac (ISO) diethyl phthalate (ISO) diethylstilbestrol (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) dinophysistoxin 1 (EXP) dioxygen (EXP,ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (EXP) dizocilpine maleate (ISO) dorsomorphin (EXP) doxorubicin (EXP,ISO) endosulfan (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (EXP) etoposide (EXP,ISO) Evodiamine (ISO) fenthion (ISO) flavonoids (ISO) fluoxetine (EXP) flutamide (ISO) folpet (ISO) fructose (ISO) fumonisin B1 (ISO) furan (ISO) furfural (EXP) genistein (ISO) glucose (ISO) GSK-J4 (EXP) haloperidol (ISO) herbicide (ISO) hydroxyurea (ISO) indometacin (EXP) iron atom (EXP) iron(0) (EXP) isobutanol (EXP) ivermectin (EXP) ketamine (ISO) lead diacetate (EXP,ISO) Macrosphelide A (EXP) maneb (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methidathion (ISO) methimazole (ISO) methoxychlor (ISO) methyl methanesulfonate (EXP) methylarsonic acid (ISO) methylparaben (EXP) mifepristone (EXP) N-methyl-4-phenylpyridinium (ISO) nickel atom (EXP) nickel dichloride (ISO) nickel sulfate (EXP) niclosamide (EXP) nitrates (ISO) NMN zwitterion (ISO) obeticholic acid (EXP) okadaic acid (EXP) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (EXP) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorobutyric acid (ISO) perfluorononanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) Pf-06840003 (ISO) phenobarbital (ISO) phenylmercury acetate (EXP) phenylpropanolamine (ISO) picoxystrobin (EXP) pirinixic acid (ISO) potassium chromate (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propiconazole (ISO) quercetin (EXP) resveratrol (EXP,ISO) rotenone (EXP,ISO) S-nitrosoglutathione (EXP) sarin (ISO) SB 431542 (EXP) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) SKF 38393 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (EXP) sodium dichromate (ISO) sodium fluoride (ISO) Soman (ISO) sotorasib (EXP) sulindac sulfide (EXP) T-2 toxin (ISO) tamoxifen (ISO) tapentadol (EXP) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (EXP) theophylline (EXP) thimerosal (EXP) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) trametinib (EXP) triclosan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP) Triptolide (ISO) tunicamycin (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vincristine (EXP) vorinostat (EXP) Yessotoxin (EXP) yohimbine (ISO) zearalenone (ISO) zinc dichloride (EXP)
1.
Neuronal surface glycolytic enzymes are autoantigen targets in post-streptococcal autoimmune CNS disease.
Dale RC, etal., J Neuroimmunol. 2006 Mar;172(1-2):187-97. Epub 2005 Dec 13.
2.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
3.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
4.
Aldolase C/zebrin II is released to the extracellular space after stroke and inhibits the network activity of cortical neurons.
Linke S, etal., Neurochem Res. 2006 Nov;31(11):1297-303. Epub 2006 Oct 20.
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
The complete amino acid sequence of the human aldolase C isozyme derived from genomic clones.
Rottmann WH, etal., Biochimie 1987 Feb;69(2):137-45.
8.
Molecular cloning and expression of rat aldolase C messenger RNA during development and hepatocarcinogenesis.
Skala H, etal., Eur J Biochem. 1987 Mar 16;163(3):513-8.
9.
Spatiotemporal analysis of purkinje cell degeneration relative to parasagittal expression domains in a model of neonatal viral infection.
Williams BL, etal., J Virol. 2007 Mar;81(6):2675-87. Epub 2006 Dec 20.
ALDOC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 28,573,120 - 28,576,895 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 28,573,115 - 28,576,948 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 26,900,138 - 26,903,913 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 23,924,260 - 23,928,078 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 23,924,265 - 23,927,989 NCBI Celera 17 23,759,160 - 23,762,978 (-) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 23,108,999 - 23,112,817 (-) NCBI HuRef CHM1_1 17 26,961,834 - 26,965,652 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 29,515,745 - 29,519,520 (-) NCBI T2T-CHM13v2.0
Aldoc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 78,213,899 - 78,218,607 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 78,213,794 - 78,218,607 (+) Ensembl GRCm39 Ensembl GRCm38 11 78,323,073 - 78,327,781 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 78,322,968 - 78,327,781 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 78,137,700 - 78,140,262 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 78,140,393 - 78,142,955 (+) NCBI MGSCv36 mm8 Celera 11 87,956,279 - 87,958,841 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.74 NCBI
Aldoc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 63,715,544 - 63,719,133 (+) NCBI GRCr8 mRatBN7.2 10 63,217,477 - 63,221,066 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 63,217,451 - 63,221,066 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 67,849,778 - 67,853,367 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 67,355,127 - 67,358,716 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 62,826,255 - 62,829,844 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 65,586,504 - 65,590,093 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 65,586,504 - 65,590,126 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 66,049,065 - 66,052,654 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 64,308,826 - 64,312,415 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 64,322,448 - 64,326,038 (-) NCBI Celera 10 62,195,147 - 62,198,736 (+) NCBI Celera Cytogenetic Map 10 q25 NCBI
Aldoc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 4,576,913 - 4,580,999 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 4,576,913 - 4,580,999 (+) NCBI ChiLan1.0 ChiLan1.0
ALDOC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 35,883,364 - 35,887,202 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 37,763,485 - 37,767,324 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 28,198,895 - 28,202,950 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 28,702,447 - 28,706,507 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 28,700,976 - 28,706,507 (+) Ensembl panpan1.1 panPan2
ALDOC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 42,778,637 - 42,782,950 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 42,778,637 - 42,782,479 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 41,935,297 - 41,939,139 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 43,597,372 - 43,601,698 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 43,597,399 - 43,601,698 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 42,380,447 - 42,384,288 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 42,673,144 - 42,676,986 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 42,750,567 - 42,754,409 (-) NCBI UU_Cfam_GSD_1.0
Aldoc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 41,921,047 - 41,924,788 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 4,798,989 - 4,802,994 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 4,798,991 - 4,802,700 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ALDOC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 44,822,780 - 44,827,597 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 44,823,376 - 44,827,273 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 46,807,780 - 46,811,676 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ALDOC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 22,342,750 - 22,346,811 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 22,341,318 - 22,346,620 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 7,779,923 - 7,784,075 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Aldoc
.
Predicted Target Of
Count of predictions: 2865 Count of miRNA genes: 662 Interacting mature miRNAs: 795 Transcripts: ENST00000226253, ENST00000395319, ENST00000395321, ENST00000435638, ENST00000460201, ENST00000578590, ENST00000581807, ENST00000582381, ENST00000584086 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298406 BP16_H Blood pressure QTL 16 (human) 0.0004 Blood pressure hypertension susceptibility 17 14778647 40778647 Human
G21480
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,904,611 - 26,904,738 UniSTS GRCh37 Build 36 17 23,928,738 - 23,928,865 RGD NCBI36 Celera 17 23,763,638 - 23,763,765 RGD Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 17 cen-q12 UniSTS HuRef 17 23,113,477 - 23,113,604 UniSTS
RH102973
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,904,722 - 26,905,258 UniSTS GRCh37 Build 36 17 23,928,849 - 23,929,385 RGD NCBI36 Celera 17 23,763,749 - 23,764,285 RGD Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 17 cen-q12 UniSTS HuRef 17 23,113,588 - 23,114,124 UniSTS
ALDOC_8198
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 26,900,072 - 26,900,581 UniSTS GRCh37 Build 36 17 23,924,199 - 23,924,708 RGD NCBI36 Celera 17 23,759,099 - 23,759,608 RGD HuRef 17 23,108,938 - 23,109,447 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2435
2788
2253
4974
1725
2348
6
623
1950
465
2270
7299
6469
52
3734
851
1743
1613
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000226253 ⟹ ENSP00000226253
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,573,120 - 28,576,895 (-) Ensembl
Ensembl Acc Id:
ENST00000395319 ⟹ ENSP00000378729
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,573,115 - 28,576,885 (-) Ensembl
Ensembl Acc Id:
ENST00000395321 ⟹ ENSP00000378731
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,573,115 - 28,576,948 (-) Ensembl
Ensembl Acc Id:
ENST00000435638 ⟹ ENSP00000398976
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,788 - 28,576,398 (-) Ensembl
Ensembl Acc Id:
ENST00000460201 ⟹ ENSP00000463174
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,696 - 28,575,914 (-) Ensembl
Ensembl Acc Id:
ENST00000578590 ⟹ ENSP00000463118
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,964 - 28,576,424 (-) Ensembl
Ensembl Acc Id:
ENST00000581807 ⟹ ENSP00000465623
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,714 - 28,576,894 (-) Ensembl
Ensembl Acc Id:
ENST00000582381
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,979 - 28,576,891 (-) Ensembl
Ensembl Acc Id:
ENST00000584086 ⟹ ENSP00000462674
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 28,574,710 - 28,576,895 (-) Ensembl
RefSeq Acc Id:
NM_005165 ⟹ NP_005156
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 28,573,120 - 28,576,895 (-) NCBI GRCh37 17 26,900,133 - 26,904,282 (-) NCBI Build 36 17 23,924,260 - 23,928,078 (-) NCBI Archive HuRef 17 23,108,999 - 23,112,817 (-) ENTREZGENE CHM1_1 17 26,961,834 - 26,965,652 (-) NCBI T2T-CHM13v2.0 17 29,515,745 - 29,519,520 (-) NCBI
Sequence:
ATTTACCAGAGGGAGCCAGGGCTGCAGCCTCATCTGTTTGCGGATCAGAACCCGAGCTGTGCTTGTGGCTGCGGCTGCTAACTGGCTGCGCACAGGGAGCTGTCACCATGCCTCACTCGTACCCAGCC
hide sequence
RefSeq Acc Id:
XM_005257949 ⟹ XP_005258006
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 28,573,120 - 28,576,895 (-) NCBI GRCh37 17 26,900,133 - 26,904,282 (-) NCBI
Sequence:
TGGTCAGGGCGGGGCATGCAGGCCACGCCCCCGGAGGAGTCACGTAGCTCTGCGACATCCGCAGCCTCATTTACCAGAGGGAGCCAGGGCTGCAGCCTCATCTGTTTGCGGATCAGAACCCGAGCTGT
hide sequence
RefSeq Acc Id:
XM_011524556 ⟹ XP_011522858
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 28,573,120 - 28,576,895 (-) NCBI
Sequence:
ATCCGCAGCCTCATTTACCAGAGGGAGCCAGGGCTGCAGCCTCATCTGTTTGCGGATCAGAACCCGAGCTGTGCTTGTGGCTGCGGCTGCTAACTGGCTGCGCACAGCTGAGAGAAGAGGGTGGCAAT
hide sequence
RefSeq Acc Id:
XM_054315543 ⟹ XP_054171518
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 29,515,745 - 29,519,520 (-) NCBI
RefSeq Acc Id:
XM_054315544 ⟹ XP_054171519
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 29,515,745 - 29,519,520 (-) NCBI
RefSeq Acc Id:
NP_005156 ⟸ NM_005165
- UniProtKB:
Q6FH94 (UniProtKB/Swiss-Prot), Q3SYL3 (UniProtKB/Swiss-Prot), B2R5R3 (UniProtKB/Swiss-Prot), Q6P0L5 (UniProtKB/Swiss-Prot), P09972 (UniProtKB/Swiss-Prot), A0A024QZ64 (UniProtKB/TrEMBL), B7Z1Y2 (UniProtKB/TrEMBL)
- Sequence:
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGL
hide sequence
RefSeq Acc Id:
XP_005258006 ⟸ XM_005257949
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH94 (UniProtKB/Swiss-Prot), Q3SYL3 (UniProtKB/Swiss-Prot), B2R5R3 (UniProtKB/Swiss-Prot), Q6P0L5 (UniProtKB/Swiss-Prot), P09972 (UniProtKB/Swiss-Prot), A0A024QZ64 (UniProtKB/TrEMBL), B7Z1Y2 (UniProtKB/TrEMBL)
- Sequence:
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGL
hide sequence
RefSeq Acc Id:
XP_011522858 ⟸ XM_011524556
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH94 (UniProtKB/Swiss-Prot), Q3SYL3 (UniProtKB/Swiss-Prot), B2R5R3 (UniProtKB/Swiss-Prot), Q6P0L5 (UniProtKB/Swiss-Prot), P09972 (UniProtKB/Swiss-Prot), A0A024QZ64 (UniProtKB/TrEMBL), B7Z1Y2 (UniProtKB/TrEMBL)
- Sequence:
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGL
hide sequence
Ensembl Acc Id:
ENSP00000465623 ⟸ ENST00000581807
Ensembl Acc Id:
ENSP00000462674 ⟸ ENST00000584086
Ensembl Acc Id:
ENSP00000463118 ⟸ ENST00000578590
Ensembl Acc Id:
ENSP00000378729 ⟸ ENST00000395319
Ensembl Acc Id:
ENSP00000378731 ⟸ ENST00000395321
Ensembl Acc Id:
ENSP00000463174 ⟸ ENST00000460201
Ensembl Acc Id:
ENSP00000398976 ⟸ ENST00000435638
Ensembl Acc Id:
ENSP00000226253 ⟸ ENST00000226253
RefSeq Acc Id:
XP_054171519 ⟸ XM_054315544
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH94 (UniProtKB/Swiss-Prot), Q3SYL3 (UniProtKB/Swiss-Prot), P09972 (UniProtKB/Swiss-Prot), B2R5R3 (UniProtKB/Swiss-Prot), Q6P0L5 (UniProtKB/Swiss-Prot), B7Z1Y2 (UniProtKB/TrEMBL), A0A024QZ64 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054171518 ⟸ XM_054315543
- Peptide Label:
isoform X1
- UniProtKB:
Q6FH94 (UniProtKB/Swiss-Prot), Q3SYL3 (UniProtKB/Swiss-Prot), P09972 (UniProtKB/Swiss-Prot), B2R5R3 (UniProtKB/Swiss-Prot), Q6P0L5 (UniProtKB/Swiss-Prot), B7Z1Y2 (UniProtKB/TrEMBL), A0A024QZ64 (UniProtKB/TrEMBL)
RGD ID: 6851422 Promoter ID: EP73511 Type: multiple initiation site Name: HS_ALDOC Description: Aldolase C, fructose-bisphosphate. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 17 23,928,040 - 23,928,100 EPD
RGD ID: 7234383 Promoter ID: EPDNEW_H22936 Type: initiation region Name: ALDOC_2 Description: aldolase, fructose-bisphosphate C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22937 EPDNEW_H22938 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 28,574,721 - 28,574,781 EPDNEW
RGD ID: 7234381 Promoter ID: EPDNEW_H22937 Type: initiation region Name: ALDOC_3 Description: aldolase, fructose-bisphosphate C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22936 EPDNEW_H22938 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 28,575,575 - 28,575,635 EPDNEW
RGD ID: 7234385 Promoter ID: EPDNEW_H22938 Type: initiation region Name: ALDOC_1 Description: aldolase, fructose-bisphosphate C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H22937 EPDNEW_H22936 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 28,576,895 - 28,576,955 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-08
ALDOC
aldolase, fructose-bisphosphate C
ALDOC
aldolase C, fructose-bisphosphate
Symbol and/or name change
5135510 APPROVED
