Advanced Search (OLGA)

Gene: Lxn (latexin) Rattus norvegicus

Analyze

Symbol:

Lxn

Name:

latexin

RGD ID:

68361

Description:

Predicted to enable metalloendopeptidase inhibitor activity. Predicted to be involved in inflammatory response. Predicted to act upstream of or within detection of temperature stimulus involved in sensory perception of pain. Predicted to be located in cytoplasm. Predicted to be active in extracellular space. Orthologous to human LXN (latexin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ECI; endogenous carboxypeptidase inhibitor; MGC93322; TCI; tissue carboxypeptidase inhibitor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LXN (latexin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Lxn (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lxn (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LXN (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LXN (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lxn (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LXN (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LXN (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lxn (latexin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Lxn (latexin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LXN (latexin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lxn (latexin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	154,037,604 - 154,043,473 (-)	NCBI		GRCr8
mRatBN7.2	2	151,727,556 - 151,733,426 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	151,727,102 - 151,733,460 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	158,844,126 - 158,849,894 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	156,894,624 - 156,900,393 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	151,527,375 - 151,533,143 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	164,628,565 - 164,634,434 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	164,628,566 - 164,634,434 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	183,977,968 - 183,983,837 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	157,310,036 - 157,315,905 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	157,259,999 - 157,265,868 (-)	NCBI
Celera	2	146,097,077 - 146,102,946 (-)	NCBI		Celera
Cytogenetic Map	2	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chromosomal Instability (ISO)

melanoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

alachlor (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (EXP)

biochanin A (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Brodifacoum (EXP)

calcitriol (ISO)

choline (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

diclofenac (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

etoposide (ISO)

flavonoids (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glycidyl methacrylate (ISO)

indole-3-methanol (EXP)

L-ascorbic acid (ISO)

L-methionine (ISO)

lucanthone (ISO)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

mifepristone (ISO)

Muraglitazar (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-ethyl-N-nitrosourea (EXP)

N-nitrosodiethylamine (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

phenobarbital (EXP)

piroxicam (ISO)

potassium chromate (ISO)

progesterone (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloromethane (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triadimefon (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of temperature stimulus involved in sensory perception of pain (ISO)

inflammatory response (IEA)

Cellular Component

cytoplasm (IEA)

extracellular space (IBA)

Molecular Function

heparin binding (IEA)

metalloendopeptidase inhibitor activity (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Intracortical regionality represented by specific transcription for a novel protein, latexin.	Hatanaka Y, etal., Eur J Neurosci 1994 Jun 1;6(6):973-82.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Genomic organization and regulatory elements of the rat latexin gene, which is expressed in a cell type-specific manner in both central and peripheral nervous systems.	Miyasaka N, etal., Brain Res Mol Brain Res 1999 May 21;69(1):62-72.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Purification, cDNA cloning, functional expression, and characterization of a 26-kDa endogenous mammalian carboxypeptidase inhibitor.	Normant E, etal., Proc Natl Acad Sci U S A 1995 Dec 19;92(26):12225-9.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:16469302	PMID:21572518	PMID:22206666	PMID:23376485	PMID:30053369	PMID:31313823

Genomics

Comparative Map Data

Lxn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	154,037,604 - 154,043,473 (-)	NCBI		GRCr8
mRatBN7.2	2	151,727,556 - 151,733,426 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	151,727,102 - 151,733,460 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	158,844,126 - 158,849,894 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	156,894,624 - 156,900,393 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	151,527,375 - 151,533,143 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	164,628,565 - 164,634,434 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	164,628,566 - 164,634,434 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	183,977,968 - 183,983,837 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	157,310,036 - 157,315,905 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	157,259,999 - 157,265,868 (-)	NCBI
Celera	2	146,097,077 - 146,102,946 (-)	NCBI		Celera
Cytogenetic Map	2	q32	NCBI

LXN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	158,666,414 - 158,672,648 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	158,645,822 - 158,672,648 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	158,384,203 - 158,390,437 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	159,866,900 - 159,873,176 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	159,866,907 - 159,873,184	NCBI
Celera	3	156,806,788 - 156,813,067 (-)	NCBI		Celera
Cytogenetic Map	3	q25.32	NCBI
HuRef	3	155,780,049 - 155,786,328 (-)	NCBI		HuRef
CHM1_1	3	158,347,170 - 158,353,449 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	161,440,336 - 161,446,570 (-)	NCBI		T2T-CHM13v2.0

Lxn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	67,365,332 - 67,371,240 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	67,365,331 - 67,371,259 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	67,457,999 - 67,463,907 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	67,457,998 - 67,463,926 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	67,261,921 - 67,267,829 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	67,545,928 - 67,551,836 (-)	NCBI		MGSCv36	mm8
Celera	3	67,584,098 - 67,590,006 (-)	NCBI		Celera
Cytogenetic Map	3	E1	NCBI
cM Map	3	30.98	NCBI

Lxn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	9,414,721 - 9,421,575 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955448	9,414,721 - 9,421,575 (-)	NCBI	ChiLan1.0	ChiLan1.0

LXN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	156,608,664 - 156,617,760 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	156,613,379 - 156,619,970 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	155,692,283 - 155,698,605 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	163,743,319 - 163,749,614 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	163,743,319 - 163,749,614 (-)	Ensembl	panpan1.1		panPan2

LXN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	51,962,877 - 51,968,447 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	51,962,873 - 51,969,172 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	51,772,677 - 51,778,236 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	52,601,679 - 52,609,457 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	52,603,873 - 52,610,212 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	52,182,014 - 52,189,772 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	52,234,990 - 52,242,749 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	52,520,422 - 52,528,212 (-)	NCBI		UU_Cfam_GSD_1.0

Lxn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	84,460,719 - 84,466,968 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	5,266,664 - 5,273,245 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	5,266,988 - 5,273,227 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LXN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	98,435,320 - 98,441,785 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	98,435,318 - 98,441,823 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	106,728,207 - 106,734,674 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LXN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	32,170,100 - 32,177,239 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	32,171,183 - 32,180,384 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	4,734,054 - 4,740,325 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lxn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	36,379,576 - 36,388,760 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	36,382,179 - 36,388,785 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lxn
46 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	42
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000018402
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	129164097	152195315	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	118111229	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	118189491	163189491	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147686913	168355276	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

Markers in Region

RH129668

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	151,727,560 - 151,727,742 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	164,628,570 - 164,628,751	NCBI	Rnor6.0
Rnor_5.0	2	183,977,973 - 183,978,154	UniSTS	Rnor5.0
RGSC_v3.4	2	157,310,041 - 157,310,222	UniSTS	RGSC3.4
Celera	2	146,097,082 - 146,097,263	UniSTS
RH 3.4 Map	2	995.7	UniSTS
Cytogenetic Map	2	q31	UniSTS

RH129902

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	151,727,636 - 151,727,835 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	164,628,646 - 164,628,844	NCBI	Rnor6.0
Rnor_5.0	2	183,978,049 - 183,978,247	UniSTS	Rnor5.0
RGSC_v3.4	2	157,310,117 - 157,310,315	UniSTS	RGSC3.4
Celera	2	146,097,158 - 146,097,356	UniSTS
RH 3.4 Map	2	995.8	UniSTS
Cytogenetic Map	2	q31	UniSTS

RH138806

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	151,730,685 - 151,730,845 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	164,631,695 - 164,631,854	NCBI	Rnor6.0
Rnor_5.0	2	183,981,098 - 183,981,257	UniSTS	Rnor5.0
RGSC_v3.4	2	157,313,166 - 157,313,325	UniSTS	RGSC3.4
Celera	2	146,100,207 - 146,100,366	UniSTS
RH 3.4 Map	2	995.8	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U40260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X76985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y18435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018402 ⟹ ENSRNOP00000018402

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	151,727,102 - 151,733,460 (-)	Ensembl
Rnor_6.0 Ensembl	2	164,628,566 - 164,634,434 (-)	Ensembl

RefSeq Acc Id:

NM_031655 ⟹ NP_113843

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	154,037,604 - 154,043,473 (-)	NCBI
mRatBN7.2	2	151,727,556 - 151,733,426 (-)	NCBI
Rnor_6.0	2	164,628,565 - 164,634,434 (-)	NCBI
Rnor_5.0	2	183,977,968 - 183,983,837 (-)	NCBI
RGSC_v3.4	2	157,310,036 - 157,315,905 (-)	RGD
Celera	2	146,097,077 - 146,102,946 (-)	RGD

Sequence:

show sequence

GGAAGAGGGAAGAAGGCGCTGAGGACCGCGCACGCCCAGCCCAGCTGCTGACTTCACCACCTCA
CCGAGACCCACTCCGCTGGCCAGCACGCTACACTGACAGGATCCTGGCTGCACCCACTGTGATC
TCTTTGAACTAGGATAGCCCGCGCTCACTGTTTCCCTGAAGATGGAAGAAATCCCACCCACCCA
CTACGCTGCGTCCAGGGCTGCCTCGGTGGCAGAGAACTGTATAAATTATCAGCAAGGGACCCCC
AACAAGGTATTCAAGGTGCAGACGGTCCAGCAGGCAAGCAAGGAGGATATCCCAGGAAGAGGCC
ACAAGTACCATCTGAAGTTTTCTGTGGAAGAAATTATCCAAAAACAAGTTACAGTGAGCTGCAC
GGCTGAAGTTCTTTACCCTCGAATGGGACAAGGCTCTGCACCGGAAGTCAACTTCACATTTGAA
GGAGAAATCGGCAAGAACCCAGATGAGGAAGACAACACGTTTTATCAAAGACTCATGTCCATGA
AGGAACCACTACAAGCACAAAATATTCCAGACAATTTTGGAAATGTGTCTCCACAAATGAAGCC
GGTCCACCACTTAGCCTGGGTCGCCTGTGGTTATGTAATGTGGCAGAACTCGACTGAAGACACA
TGGTATAAAATGGCAAAGATTCAAACGGTCAAGCAAGTGCAAAGAAACGATGACTTCATTGAGT
TAGACTACACCGTCCTACTCCACGACGTTGCATCGCAGGAGATTATCCCCTGGCAAATGCAAGT
TCTGTGGCACCCACAATACGGCACAAAAGTAAAGCACAACAGCCGCCTCCCAAAGGAAGCACCA
GCAGAGTAAACAAGACCCCAACTCGGAGACAGCCGTCAACATGCCCCTTAACCATGAGTATGAC
TGTCCTCACTGGCACCTAGCTAACAGGCCAAGTGAATCCCACAGTGTCGCTCTGTATGTCTTGG
CTACAGGACCGAGCTGCATAGATTCCACAATAAAGAGTAGACTACATGAAAGTGTCTTTCCAAT
AGTAATGGTACTATGGCTATCCACTAATAAAGTCAACTTCAGCCTCACAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113843	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52381	(Get FASTA)	NCBI Sequence Viewer
	AAH81763	(Get FASTA)	NCBI Sequence Viewer
	CAA54290	(Get FASTA)	NCBI Sequence Viewer
	CAA77175	(Get FASTA)	NCBI Sequence Viewer
	EDM00924	(Get FASTA)	NCBI Sequence Viewer
	EDM00925	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018402.2
	ENSRNOP00055005414
	ENSRNOP00060001155
	ENSRNOP00065036058
GenBank Protein	Q64361	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113843 ⟸ NM_031655

- UniProtKB:

Q64361 (UniProtKB/Swiss-Prot), A6J5L5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEEIPPTHYAASRAASVAENCINYQQGTPNKVFKVQTVQQASKEDIPGRGHKYHLKFSVEEIIQ
KQVTVSCTAEVLYPRMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQRLMSMKEPLQAQNIPDNFG
NVSPQMKPVHHLAWVACGYVMWQNSTEDTWYKMAKIQTVKQVQRNDDFIELDYTVLLHDVASQE
IIPWQMQVLWHPQYGTKVKHNSRLPKEAPAE

hide sequence

Ensembl Acc Id:

ENSRNOP00000018402 ⟸ ENSRNOT00000018402

Protein Domains

Cystatin LXN-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64361-F1-model_v2	AlphaFold	Q64361	1-223	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691366

Promoter ID:

EPDNEW_R1891

Type:

initiation region

Name:

Lxn_1

Description:

latexin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	164,634,452 - 164,634,512	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68361	AgrOrtholog
BioCyc Gene	G2FUF-52865	BioCyc
Ensembl Genes	ENSRNOG00000013572	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055004577	UniProtKB/Swiss-Prot
	ENSRNOG00060001343	UniProtKB/Swiss-Prot
	ENSRNOG00065025537	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018402.6	UniProtKB/Swiss-Prot
	ENSRNOT00055007250	UniProtKB/Swiss-Prot
	ENSRNOT00060001950	UniProtKB/Swiss-Prot
	ENSRNOT00065043974	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.450.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7125782	IMAGE-MGC_LOAD
InterPro	CYSTATIN_LXN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cystatin_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_inh_latexin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:59073	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93322	IMAGE-MGC_LOAD
NCBI Gene	59073	ENTREZGENE
PANTHER	LATEXIN	UniProtKB/Swiss-Prot
	LATEXIN	UniProtKB/TrEMBL
	LATEXIN	UniProtKB/TrEMBL
	PTHR28591	UniProtKB/Swiss-Prot
Pfam	Latexin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Latexin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Lxn	PhenoGen
PIRSF	Prot_inh_latexin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CYSTATIN_LXN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013572	RatGTEx
	ENSRNOG00055004577	RatGTEx
	ENSRNOG00060001343	RatGTEx
	ENSRNOG00065025537	RatGTEx
Superfamily-SCOP	Cystatin/monellin	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6J5L5	ENTREZGENE, UniProtKB/TrEMBL
	A6J5L6_RAT	UniProtKB/TrEMBL
	LXN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Lxn	latexin			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	enriched in central and peripheral nervous systems, present in lung	633266
gene_protein	223 amino acids	633266

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD