Symbol:
Mnat1
Name:
MNAT1 component of CDK activating kinase
RGD ID:
628874
Description:
Predicted to enable cyclin-dependent protein serine/threonine kinase activator activity and zinc ion binding activity. Involved in G1/S transition of mitotic cell cycle; negative regulation of apoptotic process; and positive regulation of smooth muscle cell proliferation. Predicted to be located in chromosome; cytoplasm; and nucleus. Predicted to be part of CAK-ERCC2 complex; RNA polymerase II transcription regulator complex; and cyclin-dependent protein kinase holoenzyme complex. Orthologous to human MNAT1 (MNAT1 component of CDK activating kinase); PARTICIPATES IN RNA polymerase II transcription initiation pathway; nucleotide excision repair pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CDK-activating kinase assembly factor MAT1; menage a trois 1; menage a trois homolog 1, cyclin H assembly factor; menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis); MNAT CDK-activating kinase assembly factor 1; MNAT1, CDK activating kinase assembly factor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MNAT1 (MNAT1 component of CDK activating kinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mnat1 (menage a trois 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mnat1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MNAT1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MNAT1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mnat1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MNAT1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MNAT1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mnat1 (MNAT1 component of CDK activating kinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MNAT1 (MNAT1 component of CDK activating kinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mnat1 (menage a trois 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mnat1 (MNAT1 component of CDK activating kinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mnat-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Mat1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TFB3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 97,550,566 - 97,706,598 (+) NCBI GRCr8 mRatBN7.2 6 91,814,703 - 91,971,945 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 91,814,749 - 91,970,744 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,215,265 - 92,360,395 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,514,762 - 92,659,893 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 91,942,664 - 92,087,783 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 95,995,341 - 96,153,331 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 96,007,805 - 96,153,330 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,442,513 - 105,587,335 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 95,548,845 - 95,698,573 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 95,552,300 - 95,702,028 (+) NCBI Celera 6 90,288,391 - 90,433,268 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
1.
A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor.
Egly JM and Coin F, DNA Repair (Amst). 2011 Jul 15;10(7):714-21. doi: 10.1016/j.dnarep.2011.04.021. Epub 2011 May 17.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
5.
GOA pipeline
RGD automated data pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Information Derived from GenBank Report
RGD, Sept. 2003
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
RNA antisense abrogation of MAT1 induces G1 phase arrest and triggers apoptosis in aortic smooth muscle cells.
Wu L, etal., J Biol Chem. 1999 Feb 26;274(9):5564-72.
Mnat1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 97,550,566 - 97,706,598 (+) NCBI GRCr8 mRatBN7.2 6 91,814,703 - 91,971,945 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 91,814,749 - 91,970,744 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,215,265 - 92,360,395 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,514,762 - 92,659,893 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 91,942,664 - 92,087,783 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 95,995,341 - 96,153,331 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 96,007,805 - 96,153,330 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,442,513 - 105,587,335 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 95,548,845 - 95,698,573 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 95,552,300 - 95,702,028 (+) NCBI Celera 6 90,288,391 - 90,433,268 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
MNAT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 60,734,761 - 60,969,965 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 60,734,742 - 60,969,965 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 61,201,479 - 61,436,683 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 60,271,223 - 60,505,151 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 60,271,222 - 60,505,151 NCBI Celera 14 41,251,714 - 41,485,662 (+) NCBI Celera Cytogenetic Map 14 q23.1 NCBI HuRef 14 41,364,391 - 41,598,757 (+) NCBI HuRef CHM1_1 14 61,140,780 - 61,374,681 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 54,941,243 - 55,176,505 (+) NCBI T2T-CHM13v2.0
Mnat1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 73,158,957 - 73,320,762 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 73,170,491 - 73,320,762 (+) Ensembl GRCm39 Ensembl GRCm38 12 73,112,185 - 73,273,988 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 73,123,717 - 73,273,988 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 74,224,704 - 74,374,975 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 74,042,567 - 74,191,687 (+) NCBI MGSCv36 mm8 Celera 12 74,235,147 - 74,385,303 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 30.37 NCBI
Mnat1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 8,690,960 - 8,895,021 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 8,690,960 - 8,895,021 (-) NCBI ChiLan1.0 ChiLan1.0
MNAT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 61,872,516 - 62,105,486 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 61,089,035 - 61,321,999 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 41,342,530 - 41,576,690 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 59,603,209 - 59,835,408 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 59,603,209 - 59,835,408 (+) Ensembl panpan1.1 panPan2
MNAT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 35,747,883 - 35,946,353 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 35,756,933 - 35,946,353 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 35,510,966 - 35,699,760 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 35,990,042 - 36,179,803 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 35,990,189 - 36,179,799 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 35,602,177 - 35,790,354 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 35,679,632 - 35,867,792 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 36,041,067 - 36,229,645 (+) NCBI UU_Cfam_GSD_1.0
Mnat1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 69,063,584 - 69,282,287 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 4,909,380 - 5,128,113 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 4,909,427 - 5,128,113 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MNAT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 189,690,354 - 189,910,589 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 189,690,343 - 189,908,144 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 210,944,891 - 210,956,358 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MNAT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 37,922,347 - 38,161,467 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 37,922,353 - 38,162,226 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 26,174,914 - 26,419,489 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mnat1
.
Predicted Target Of
Count of predictions: 268 Count of miRNA genes: 187 Interacting mature miRNAs: 206 Transcripts: ENSRNOT00000010163 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
D6Got118
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 97,676,514 - 97,676,639 (+) Marker Load Pipeline mRatBN7.2 6 91,940,658 - 91,940,783 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,123,145 - 96,123,269 NCBI Rnor6.0 Rnor_5.0 6 105,557,501 - 105,557,625 UniSTS Rnor5.0 RGSC_v3.4 6 95,666,280 - 95,666,405 RGD RGSC3.4 RGSC_v3.4 6 95,666,281 - 95,666,405 UniSTS RGSC3.4 RGSC_v3.1 6 95,669,737 - 95,669,861 RGD Celera 6 90,403,082 - 90,403,206 UniSTS RH 3.4 Map 6 661.4 UniSTS RH 3.4 Map 6 661.4 RGD Cytogenetic Map 6 q24 UniSTS
BE120601
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 91,966,552 - 91,966,728 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,149,140 - 96,149,315 NCBI Rnor6.0 Rnor_5.0 6 105,583,144 - 105,583,319 UniSTS Rnor5.0 RGSC_v3.4 6 95,694,382 - 95,694,557 UniSTS RGSC3.4 Celera 6 90,429,077 - 90,429,252 UniSTS RH 3.4 Map 6 657.7 UniSTS Cytogenetic Map 6 q24 UniSTS
AI008314
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 91,840,783 - 91,840,964 (+) MAPPER mRatBN7.2 Rnor_6.0 6 96,023,311 - 96,023,491 NCBI Rnor6.0 Rnor_5.0 6 105,458,019 - 105,458,199 UniSTS Rnor5.0 RGSC_v3.4 6 95,564,920 - 95,565,100 UniSTS RGSC3.4 Celera 6 90,303,861 - 90,304,041 UniSTS RH 3.4 Map 6 661.5 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010163 ⟹ ENSRNOP00000010163
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,814,749 - 91,970,742 (+) Ensembl Rnor_6.0 Ensembl 6 96,007,805 - 96,153,330 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102762 ⟹ ENSRNOP00000097795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,814,749 - 91,938,812 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107749 ⟹ ENSRNOP00000083064
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,814,749 - 91,898,221 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114452 ⟹ ENSRNOP00000084909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,853,034 - 91,970,744 (+) Ensembl
RefSeq Acc Id:
NM_153472 ⟹ NP_703202
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,561,156 - 97,706,598 (+) NCBI mRatBN7.2 6 91,825,283 - 91,970,744 (+) NCBI Rnor_6.0 6 96,007,805 - 96,153,331 (+) NCBI Rnor_5.0 6 105,442,513 - 105,587,335 (+) NCBI RGSC_v3.4 6 95,548,845 - 95,698,573 (+) RGD Celera 6 90,288,391 - 90,433,268 (+) RGD
Sequence:
GTGGCAGTGGCTGAAGCTGGCGTTGGGGGGAAAATCCAAAGCTGAGGAGACGCCATGGACGACCAGGGCTGCCCCAGGTGTAAGACCACCAAATACCGGAACCCTTCTTTGAAGCTGATGGTGAACGT
hide sequence
RefSeq Acc Id:
XM_063261569 ⟹ XP_063117639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,550,566 - 97,637,890 (+) NCBI
RefSeq Acc Id:
XM_063261570 ⟹ XP_063117640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,561,068 - 97,706,598 (+) NCBI
RefSeq Acc Id:
NP_703202 ⟸ NM_153472
- UniProtKB:
Q8CIR5 (UniProtKB/TrEMBL), A6HC54 (UniProtKB/TrEMBL), Q6AZ68 (UniProtKB/TrEMBL), A0A8I5ZYY1 (UniProtKB/TrEMBL)
- Sequence:
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000010163 ⟸ ENSRNOT00000010163
Ensembl Acc Id:
ENSRNOP00000083064 ⟸ ENSRNOT00000107749
Ensembl Acc Id:
ENSRNOP00000097795 ⟸ ENSRNOT00000102762
Ensembl Acc Id:
ENSRNOP00000084909 ⟸ ENSRNOT00000114452
RefSeq Acc Id:
XP_063117639 ⟸ XM_063261569
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZV40 (UniProtKB/TrEMBL), A0A8I6ATM4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063117640 ⟸ XM_063261570
- Peptide Label:
isoform X2
- UniProtKB:
F7EX11 (UniProtKB/TrEMBL), A0A8I5ZYY1 (UniProtKB/TrEMBL)
RGD ID: 13694663 Promoter ID: EPDNEW_R5187 Type: initiation region Name: Mnat1_1 Description: MNAT1, CDK activating kinase assembly factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 96,007,744 - 96,007,804 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-04
Mnat1
MNAT1 component of CDK activating kinase
Mnat1
MNAT1, CDK activating kinase assembly factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-03-29
Mnat1
MNAT1, CDK activating kinase assembly factor
Mnat1
MNAT CDK-activating kinase assembly factor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-14
Mnat1
MNAT CDK-activating kinase assembly factor 1
Mnat1
menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Mnat1
menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
Mnat1
menage a trois 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Mnat1
menage a trois 1
Symbol and Name status set to approved
1299863 APPROVED
2003-02-27
Mnat1
menage a trois 1
Symbol and Name status set to provisional
70820 PROVISIONAL
