Opn4 (opsin 4) - Rat Genome Database

Name: Opn4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Opn4 (opsin 4) Rattus norvegicus

Analyze

Symbol:

Opn4

Name:

opsin 4

RGD ID:

621701

Description:

Enables G protein-coupled photoreceptor activity. Involved in phototransduction. Predicted to be located in sperm head plasma membrane. Predicted to be active in plasma membrane. Orthologous to human OPN4 (opsin 4); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

melanopsin; opsin 4 (melanopsin); opsin-4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OPN4 (opsin 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Opn4 (opsin 4 (melanopsin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Opn4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OPN4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OPN4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Opn4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OPN4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OPN4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Opn4 (opsin 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Opn4 (opsin 4 (melanopsin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OPN4 (opsin 4)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	opn4.1 (opsin 4.1)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	opn4a (opsin 4a (melanopsin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	opn4b (opsin 4b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rh2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rh3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rh4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rh5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rh6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rh7	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ninaE	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	9,926,638 - 9,935,810 (-)	NCBI		GRCr8
mRatBN7.2	16	9,920,408 - 9,929,580 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	9,920,491 - 10,005,711 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	9,940,099 - 9,949,239 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	11,084,803 - 11,093,943 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	9,935,147 - 9,944,287 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	10,943,353 - 10,966,602 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	10,943,341 - 10,952,549 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	9,268,356 - 9,277,528 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	10,249,756 - 10,258,923 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	10,249,757 - 10,258,921 (-)	NCBI
Celera	16	5,287,559 - 5,296,704 (+)	NCBI		Celera
Cytogenetic Map	16	p15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

furan (EXP)

methimazole (EXP)

N-methyl-N-nitrosourea (EXP)

phenobarbital (EXP)

resveratrol (ISO)

streptozocin (ISO)

sulfadimethoxine (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to light stimulus (IBA)

detection of temperature stimulus involved in thermoception (ISO)

detection of visible light (IEA)

G protein-coupled receptor signaling pathway (IBA,IEA)

hyaloid vascular plexus regression (ISO,ISS)

optokinetic behavior (ISO,ISS)

phototransduction (IBA,IDA,IEA,ISO)

regulation of circadian rhythm (ISO,ISS)

retina development in camera-type eye (ISO)

rhythmic process (IEA)

thermotaxis (ISO)

visual perception (IEA)

Cellular Component

axon (IEA)

dendrite (IEA)

membrane (TAS)

perikaryon (IEA)

plasma membrane (IBA,IEA,ISO,ISS)

sperm head plasma membrane (ISO)

Molecular Function

11-cis retinal binding (ISO,ISS)

G protein-coupled photoreceptor activity (IBA,IDA,ISO)

G protein-coupled receptor activity (IEA)

photoreceptor activity (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Melanopsin-containing retinal ganglion cells: architecture, projections, and intrinsic photosensitivity.	Hattar S, etal., Science 2002 Feb 8;295(5557):1065-70.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12808468	PMID:12904470	PMID:14500998	PMID:15073514	PMID:15509757	PMID:15674244	PMID:16186625	PMID:16687290	PMID:17652756	PMID:18001324	PMID:18512147	PMID:19793992
PMID:20339872	PMID:22101014	PMID:23187103	PMID:23541830	PMID:25378407	PMID:26176868	PMID:26320947	PMID:26572076

Genomics

Comparative Map Data

Opn4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	9,926,638 - 9,935,810 (-)	NCBI		GRCr8
mRatBN7.2	16	9,920,408 - 9,929,580 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	9,920,491 - 10,005,711 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	9,940,099 - 9,949,239 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	11,084,803 - 11,093,943 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	9,935,147 - 9,944,287 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	10,943,353 - 10,966,602 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	10,943,341 - 10,952,549 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	9,268,356 - 9,277,528 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	10,249,756 - 10,258,923 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	10,249,757 - 10,258,921 (-)	NCBI
Celera	16	5,287,559 - 5,296,704 (+)	NCBI		Celera
Cytogenetic Map	16	p15	NCBI

OPN4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	86,654,547 - 86,666,460 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	86,654,518 - 86,666,460 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	88,414,304 - 88,426,217 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	88,404,294 - 88,416,197 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	88,404,377 - 88,416,192	NCBI
Celera	10	82,417,087 - 82,428,990 (+)	NCBI		Celera
Cytogenetic Map	10	q23.2	NCBI
HuRef	10	82,268,556 - 82,280,460 (+)	NCBI		HuRef
CHM1_1	10	88,695,970 - 88,707,871 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	87,538,707 - 87,550,619 (+)	NCBI		T2T-CHM13v2.0

Opn4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	34,312,575 - 34,322,099 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	34,312,575 - 34,322,099 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	34,590,618 - 34,600,142 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	34,590,618 - 34,600,142 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	35,403,804 - 35,413,328 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	33,421,454 - 33,429,234 (-)	NCBI		MGSCv36	mm8
Celera	14	30,856,294 - 30,865,818 (-)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	20.83	NCBI

Opn4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955510	5,724,120 - 5,736,135 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955510	5,723,804 - 5,736,070 (+)	NCBI	ChiLan1.0	ChiLan1.0

OPN4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	98,650,558 - 98,659,765 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	98,655,877 - 98,665,084 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	83,082,351 - 83,095,161 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1 Ensembl	10	86,641,746 - 86,653,143 (+)	Ensembl	panpan1.1		panPan2

OPN4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	34,350,058 - 34,365,410 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	34,355,128 - 34,365,215 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	34,341,511 - 34,356,871 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	34,709,962 - 34,725,323 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	34,715,036 - 34,725,123 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	34,555,991 - 34,571,338 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	34,725,234 - 34,740,584 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	35,230,251 - 35,245,607 (+)	NCBI		UU_Cfam_GSD_1.0

Opn4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	44,151,328 - 44,162,304 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936804	263,720 - 272,132 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936804	261,210 - 272,449 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OPN4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	87,647,238 - 87,658,815 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	87,645,563 - 87,660,820 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	94,902,249 - 94,913,351 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OPN4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	45,199,897 - 45,212,193 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	45,200,707 - 45,211,636 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	5,312,090 - 5,321,780 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Opn4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624841	474,035 - 482,475 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624841	472,053 - 483,623 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Opn4
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	215
Count of miRNA genes:	137
Interacting mature miRNAs:	148
Transcripts:	ENSRNOT00000015642
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	16039848	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	2851709	15884239	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Markers in Region

RH136694

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	9,920,505 - 9,920,661 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	10,943,475 - 10,943,630	NCBI	Rnor6.0
Rnor_5.0	16	9,268,454 - 9,268,609	UniSTS	Rnor5.0
RGSC_v3.4	16	10,249,849 - 10,250,004	UniSTS	RGSC3.4
Celera	16	5,296,478 - 5,296,633	UniSTS
RH 3.4 Map	16	98.3	UniSTS
Cytogenetic Map	16	p15	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low		14						3	4		3	1
Below cutoff	2	29	13	2	9	2	8	8	56	22	32	10	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001841532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY072689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000089041

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	10,947,474 - 10,948,851 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091315 ⟹ ENSRNOP00000069548

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	9,920,491 - 10,005,711 (-)	Ensembl
Rnor_6.0 Ensembl	16	10,943,341 - 10,952,549 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108205 ⟹ ENSRNOP00000079898

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	9,921,627 - 10,005,711 (-)	Ensembl

RefSeq Acc Id:

NM_138860 ⟹ NP_620215

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	9,926,638 - 9,935,810 (-)	NCBI
mRatBN7.2	16	9,920,408 - 9,929,580 (-)	NCBI
Rnor_6.0	16	10,943,377 - 10,952,549 (-)	NCBI
Rnor_5.0	16	9,268,356 - 9,277,528 (-)	NCBI
RGSC_v3.4	16	10,249,756 - 10,258,923 (-)	RGD
Celera	16	5,287,559 - 5,296,704 (+)	RGD

Sequence:

show sequence

CACTCATTCCTTTGCGCTTCATTAGACATTGAGCAGTCAGCAGCCCAAACAGCAGCTCCAGGCT
GGATCTAGGCTGGGGATGTGAACAGGGAGCCGGTGGGCCAGGCCACGGTGTTAAGGATGCTGTA
AAGCCAGCTGGGGACCGATCTGGACAATCCCTGAGCTTCCCATGCCTTTAAGTCCTCCAAGAGC
CTGAGCATGAACTCTCCTTCAGAATCAAGAGTCCCTTCAAGCTTAACTCAGGATCCCAGCTTTA
CCGCCAGCCCTGCCCTCCTACAAGGCATTTGGAACAGCACTCAGAACATCTCCGTCAGAGTCCA
GCTTCTATCCGTTAGCCCCACGACACCTGGGCTTCAGGCTGCTGCCTGGGTCCCCTTCCCCACA
GTCGACGTCCCAGATCATGCTCACTATACCCTAGGCACGGTGATCCTGCTGGTGGGACTCACAG
GGATGCTGGGTAACCTGACAGTCATCTACACCTTCTGCAGGAATAGAGGCCTGCGGACACCGGC
AAACATGCTCATCATCAACCTGGCAGTCAGCGACTTCCTTATGTCGTTCACTCAGGCCCCGGTC
TTCTTTGCCAGCAGCCTCTACAAGAAGTGGCTCTTCGGGGAGACAGGTTGCAAGTTCTATGCCT
TCTGTGGGGCTGTCTTTGGCATCGTTTCCATGATCACCCTGACAGCCATAGCCATGGACCGCTA
TCTGGTGATCACACGTCCACTGGCCACCATCGGCATGAGATCCAAGAGACGGACGGCACTAGTC
CTGCTAGGTGTCTGGCTCTATGCCCTGGCCTGGAGTCTGCCGCCTTTCTTTGGCTGGAGCGCCT
ACGTGCCCGAGGGGCTGCTGACATCCTGCTCCTGGGACTACGTGACCTTCACGCCCCTCGTGCG
CGCCTACACCATGCTGCTCTTCTGCTTTGTCTTCTTCCTCCCTCTGCTCATTATCATCTTCTGC
TACATCTTCATCTTCAGGGCCATTCGAGAGACAGGCCGGGCCTGTGAGGGCTGTGGTGAGTCCC
CTCTGCGGCGGCGGCAGTGGCAGCGGCTACAGAGTGAATGGAAGATGGCCAAGGTCGCACTGAT
CGTCATTCTCCTCTTTGTGCTGTCCTGGGCTCCCTACTCCACTGTGGCCCTGGTGGGCTTTGCT
GGGTACTCGCACATCCTGACGCCCTACATGAGCTCGGTGCCAGCCGTCATTGCCAAGGCCTCGG
CCATCCACAATCCTATCATCTATGCCATCACTCACCCCAAGTACAGGGCGGCCATTGCTCAGCA
CTTGCCTTGCCTTGGGGTGCTTCTTGGAGTATCAGGCCAGCGCAGCCACCCCTCCCTCAGCTAC
CGCTCTACCCATCGCTCCACACTGAGCAGCCAGTCCTCAGACCTCAGCTGGATCTCTGGGCAGA
AGCGCCAAGAGTCCCTGGGTTCTGAGAGTGAAGTGGGCTGGACAGACACAGAAACAACAGCTGC
GTGGGGAGCTGCCCAGCAAGCAAGTGGACAATCCTTCTGCAGTCATGACCTGGAAGATGGAGAA
GTCAAGGCTCCTTCCAGCCCCCAGGAACAGAAATCCAAGACTCCCAAGACCAAGAGACACCTCC
CCAGTCTGGACCGAAGGATGTAGGATGCCCAGTCCCGTCCCCTCCCTATCACATGCACAGACCC
GGGATTATCTCACAAGCCTGGAAGCTTTGAAGGTGTTCCTGTCACTCGTGCTACACTGGACACA
CTCTCCAGCTCCTTTCCACACCATGAAGCACCGTCGCCGCTTCTCAGCTCGGCAGCCACACCTG
GGCTCCGCCTGAAGCATGAACCCAGGTTTTCCTTTCCAGCTTCGCTTCCAGCAGCTGTCGCCTC
TCCTCAGACGCTGTATGCCGCGATTGTCCAGGCAAGGACAATGGCGATGGCGCTGGGGAACACG
TCATTTATTTATGAGCCAAGCATCTTAGCCAGCCTTTGCAACCAGGCCGGACATCTCATTGGTT
CAGAAAGTTCTTTCCTGCGTCTCCTGCTGCCAGTGCTCAAAAGCTGAAGACAGACTCTGCTTTG
TGCACCAGGAATACTTTGGCTCTAGCTCCCCCATAGCATTCACGGTGTTGCCCACACTCATATG
TTCGCGGGCACCGGCAGGCACATAGGTACCTATTTGCATGCACAGCCAGCACATGTGTGCGCAC
CCTGCACGTACTGTTTCGTGTCAGTGGTCTAAGTTCCTTCCAGATGTGGATCTGACAAGGCACG
GGAAAATAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620215	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL61854	(Get FASTA)	NCBI Sequence Viewer
	EDL88866	(Get FASTA)	NCBI Sequence Viewer
	EDL88867	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069548.1
	ENSRNOP00000079898.1
	ENSRNOP00055012365
	ENSRNOP00060019369
	ENSRNOP00065018309
GenBank Protein	Q8R456	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620215 ⟸ NM_138860

- UniProtKB:

Q8R456 (UniProtKB/Swiss-Prot), A6KFQ9 (UniProtKB/TrEMBL), A0A8I5ZNW1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNSPSESRVPSSLTQDPSFTASPALLQGIWNSTQNISVRVQLLSVSPTTPGLQAAAWVPFPTVD
VPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINLAVSDFLMSFTQAPVFF
ASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLATIGMRSKRRTALVLL
GVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPLVRAYTMLLFCFVFFLPLLIIIFCYI
FIFRAIRETGRACEGCGESPLRRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVGFAGY
SHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRAAIAQHLPCLGVLLGVSGQRSHPSLSYRS
THRSTLSSQSSDLSWISGQKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSHDLEDGEVK
APSSPQEQKSKTPKTKRHLPSLDRRM

hide sequence

Ensembl Acc Id:

ENSRNOP00000069548 ⟸ ENSRNOT00000091315

Ensembl Acc Id:

ENSRNOP00000079898 ⟸ ENSRNOT00000108205

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R456-F1-model_v2	AlphaFold	Q8R456	1-474	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621701	AgrOrtholog
BioCyc Gene	G2FUF-12055	BioCyc
Ensembl Genes	ENSRNOG00000053893	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055009127	UniProtKB/Swiss-Prot
	ENSRNOG00060014175	UniProtKB/Swiss-Prot
	ENSRNOG00065014265	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000091315.2	UniProtKB/Swiss-Prot
	ENSRNOT00000108205.1	UniProtKB/TrEMBL
	ENSRNOT00055015448	UniProtKB/Swiss-Prot
	ENSRNOT00060024270	UniProtKB/Swiss-Prot
	ENSRNOT00065023536	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Opsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Retinal_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:192223	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	192223	ENTREZGENE
PANTHER	MELANOPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Opn4	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053893	RatGTEx
	ENSRNOG00055009127	RatGTEx
	ENSRNOG00060014175	RatGTEx
	ENSRNOG00065014265	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZNW1	ENTREZGENE, UniProtKB/TrEMBL
	A6KFQ9	ENTREZGENE, UniProtKB/TrEMBL
	A6KFR0_RAT	UniProtKB/TrEMBL
	OPN4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Opn4	opsin 4	Opn4	opsin 4 (melanopsin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Opn4	opsin 4 (melanopsin)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Opn4	opsin 4 (melanopsin)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in cell bodies, dendrites, and proximal axonal segments of a subset of rat retinal ganglion cells	633348

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message