Symbol:
Opn4
Name:
opsin 4 (melanopsin)
RGD ID:
734208
MGI Page
MGI
Description:
Enables G protein-coupled photoreceptor activity. Involved in several processes, including hyaloid vascular plexus regression; optokinetic behavior; and phototransduction. Acts upstream of or within detection of temperature stimulus involved in thermoception; retina development in camera-type eye; and thermotaxis. Located in sperm head plasma membrane. Is expressed in eye and future brain. Orthologous to human OPN4 (opsin 4).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110007J02Rik; Gm533; melanopsin; opsin-4; RIKEN cDNA 1110007J02 gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OPN4 (opsin 4) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Opn4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Opn4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OPN4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OPN4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Opn4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OPN4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OPN4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Opn4 (opsin 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Opn4 (opsin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OPN4 (opsin 4)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
opn4.1 (opsin 4.1)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
opn4a (opsin 4a (melanopsin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
opn4b (opsin 4b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Rh2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rh3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rh4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rh5
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rh6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rh7
Alliance
DIOPT (Hieranoid|OrthoFinder|PhylomeDB)
Drosophila melanogaster (fruit fly):
ninaE
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 34,312,575 - 34,322,099 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 34,312,575 - 34,322,099 (-) Ensembl GRCm39 Ensembl GRCm38 14 34,590,618 - 34,600,142 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 34,590,618 - 34,600,142 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 35,403,804 - 35,413,328 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 33,421,454 - 33,429,234 (-) NCBI MGSCv36 mm8 Celera 14 30,856,294 - 30,865,818 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 20.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Opn4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 34,312,575 - 34,322,099 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 34,312,575 - 34,322,099 (-) Ensembl GRCm39 Ensembl GRCm38 14 34,590,618 - 34,600,142 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 34,590,618 - 34,600,142 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 35,403,804 - 35,413,328 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 33,421,454 - 33,429,234 (-) NCBI MGSCv36 mm8 Celera 14 30,856,294 - 30,865,818 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 20.83 NCBI
OPN4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 86,654,547 - 86,666,460 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 86,654,518 - 86,666,460 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 88,414,304 - 88,426,217 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 88,404,294 - 88,416,197 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 88,404,377 - 88,416,192 NCBI Celera 10 82,417,087 - 82,428,990 (+) NCBI Celera Cytogenetic Map 10 q23.2 NCBI HuRef 10 82,268,556 - 82,280,460 (+) NCBI HuRef CHM1_1 10 88,695,970 - 88,707,871 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 87,538,707 - 87,550,619 (+) NCBI T2T-CHM13v2.0
Opn4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 9,926,638 - 9,935,810 (-) NCBI GRCr8 mRatBN7.2 16 9,920,408 - 9,929,580 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 9,920,491 - 10,005,711 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 9,940,099 - 9,949,239 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 11,084,803 - 11,093,943 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 9,935,147 - 9,944,287 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 10,943,353 - 10,966,602 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 10,943,341 - 10,952,549 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 9,268,356 - 9,277,528 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 10,249,756 - 10,258,923 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 10,249,757 - 10,258,921 (-) NCBI Celera 16 5,287,559 - 5,296,704 (+) NCBI Celera Cytogenetic Map 16 p15 NCBI
Opn4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955510 5,724,120 - 5,736,135 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955510 5,723,804 - 5,736,070 (+) NCBI ChiLan1.0 ChiLan1.0
OPN4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 98,650,558 - 98,659,765 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 98,655,877 - 98,665,084 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 83,082,351 - 83,095,161 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 Ensembl 10 86,641,746 - 86,653,143 (+) Ensembl panpan1.1 panPan2
OPN4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 34,350,058 - 34,365,410 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 34,355,128 - 34,365,215 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 34,341,511 - 34,356,871 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 34,709,962 - 34,725,323 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 34,715,036 - 34,725,123 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 34,555,991 - 34,571,338 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 34,725,234 - 34,740,584 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 35,230,251 - 35,245,607 (+) NCBI UU_Cfam_GSD_1.0
Opn4
OPN4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 87,647,238 - 87,658,815 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 87,645,563 - 87,660,820 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 94,902,249 - 94,913,351 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OPN4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 45,199,897 - 45,212,193 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 45,200,707 - 45,211,636 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 5,312,090 - 5,321,780 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Opn4
.
Predicted Target Of
Count of predictions: 506 Count of miRNA genes: 331 Interacting mature miRNAs: 372 Transcripts: ENSMUST00000022331, ENSMUST00000168444 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 27226737 Metcl12_m metatarsal-calcaneal length 12, 10 week (mouse) 14 33221957 59437449 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 14696688 Rfq2_m rearing frequency QTL 2, males (mouse) 14 33721957 35721957 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 27226727 Tibl21_m tibia length 21, 16 week (mouse) 14 34121957 52937457 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
Opn4
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 14 B UniSTS cM Map 14 UniSTS
Opn4
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 14 B UniSTS cM Map 14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000022331 ⟹ ENSMUSP00000022331
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 34,314,300 - 34,322,099 (-) Ensembl GRCm38.p6 Ensembl 14 34,592,343 - 34,600,142 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000168444 ⟹ ENSMUSP00000126136
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 34,312,575 - 34,321,915 (-) Ensembl GRCm38.p6 Ensembl 14 34,590,618 - 34,599,958 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000226806
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 34,312,585 - 34,313,796 (-) Ensembl GRCm38.p6 Ensembl 14 34,590,628 - 34,591,839 (-) Ensembl
RefSeq Acc Id:
NM_001128599 ⟹ NP_001122071
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 34,312,575 - 34,322,099 (-) NCBI GRCm38 14 34,590,618 - 34,600,142 (-) ENTREZGENE MGSCv37 14 35,403,804 - 35,413,328 (-) RGD Celera 14 30,856,294 - 30,865,818 (-) RGD cM Map 14 ENTREZGENE
Sequence:
CACTCATTCCTTTGCGCTTCATTGGACATTAAGCAGTCAGCAGCCCAAAGAGCAGCTCCAGGCTGGATGGATGAGAGCGGGCAGCAGGTGGACCAGGCCGCAGGGTTAAGGATGGTATAGAGCCGGAA
hide sequence
RefSeq Acc Id:
NM_013887 ⟹ NP_038915
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 34,314,300 - 34,322,099 (-) NCBI GRCm38 14 34,592,343 - 34,600,142 (-) NCBI MGSCv37 14 35,403,804 - 35,413,328 (-) RGD Celera 14 30,856,294 - 30,865,818 (-) RGD cM Map 14 ENTREZGENE
Sequence:
CACTCATTCCTTTGCGCTTCATTGGACATTAAGCAGTCAGCAGCCCAAAGAGCAGCTCCAGGCTGGATGGATGAGAGCGGGCAGCAGGTGGACCAGGCCGCAGGGTTAAGGATGGTATAGAGCCGGAA
hide sequence
RefSeq Acc Id:
NP_038915 ⟸ NM_013887
- Peptide Label:
isoform 1
- UniProtKB:
A4QPG3 (UniProtKB/Swiss-Prot), B2C712 (UniProtKB/Swiss-Prot), Q9QXZ9 (UniProtKB/Swiss-Prot)
- Sequence:
MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFA
hide sequence
RefSeq Acc Id:
NP_001122071 ⟸ NM_001128599
- Peptide Label:
isoform 2
- UniProtKB:
Q9QXZ9 (UniProtKB/Swiss-Prot)
- Sequence:
MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDV
hide sequence
Ensembl Acc Id:
ENSMUSP00000022331 ⟸ ENSMUST00000022331
Ensembl Acc Id:
ENSMUSP00000126136 ⟸ ENSMUST00000168444
RGD ID: 8681940 Promoter ID: EPDNEW_M19001 Type: single initiation site Name: Opn4_1 Description: Mus musculus opsin 4 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 34,600,143 - 34,600,203 EPDNEW
RGD ID: 6824652 Promoter ID: MM_KWN:16218 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: UC007TBG.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 35,404,296 - 35,404,796 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-02
Opn4
opsin 4 (melanopsin)
1110007J02Rik
RIKEN cDNA 1110007J02 gene
Data merged from RGD:1611068
737654 PROVISIONAL
