Arf6 (ADP-ribosylation factor 6) - Rat Genome Database

Name: Arf6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Arf6 (ADP-ribosylation factor 6) Rattus norvegicus

Analyze

Symbol:

Arf6

Name:

ADP-ribosylation factor 6

RGD ID:

621279

Description:

Predicted to enable G protein activity; guanyl ribonucleotide binding activity; and thioesterase binding activity. Involved in several processes, including maintenance of postsynaptic density structure; negative regulation of dendrite development; and regulation of presynapse assembly. Located in early endosome; recycling endosome; and ruffle. Is active in glutamatergic synapse; postsynapse; and presynapse. Orthologous to human ARF6 (ADP ribosylation factor 6); PARTICIPATES IN E-cadherin signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; endocytosis pathway; INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARF6 (ADP ribosylation factor 6)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Arf6 (ADP-ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arf6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARF6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARF6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Arf6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARF6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARF6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arf6 (ADP ribosylation factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ARF6 (ADP ribosylation factor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arf6 (ADP-ribosylation factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arf6b (ADP-ribosylation factor 6b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arf6a (ADP-ribosylation factor 6a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARF3	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Arf51F	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	arf-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arf6.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	87,853,742 - 87,854,890 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	87,840,142 - 87,874,114 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,252,904 - 88,254,050 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,552,333 - 88,553,479 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	87,992,090 - 87,993,236 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	91,697,109 - 91,698,257 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	91,697,109 - 91,698,255 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,149,908 - 101,152,127 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,337,496 - 91,338,644 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	91,340,951 - 91,342,098 (+)	NCBI
Celera	6	86,351,473 - 86,352,621 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-bisphospho-D-glyceric acid (ISO)

2,3-bisphosphoglyceric acid (ISO)

2,4-dinitrotoluene (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-vinylcyclohexene dioxide (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aluminium trifluoride (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bortezomib (ISO)

butan-1-ol (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

diethylstilbestrol (ISO)

dimethylarsinic acid (EXP)

diuron (EXP)

doxorubicin (ISO)

ethanol (EXP)

folic acid (ISO)

gentamycin (EXP)

glyphosate (ISO)

inulin (ISO)

ivermectin (ISO)

lithium chloride (ISO)

N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO)

nefazodone (EXP)

ozone (EXP)

paracetamol (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

propranolol (ISO)

Soman (EXP)

superoxide (ISO)

tamibarotene (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (TAS)

cell differentiation (IEA)

cellular response to nerve growth factor stimulus (IDA)

cortical actin cytoskeleton organization (ISO)

endocytic recycling (IDA,ISO)

erythrocyte apoptotic process (ISO)

establishment of epithelial cell polarity (ISO)

hepatocyte apoptotic process (ISO)

intracellular protein transport (IBA)

liver development (ISO)

maintenance of postsynaptic density structure (IDA,IMP)

negative regulation of dendrite development (IMP)

negative regulation of protein localization to cell surface (ISO)

nervous system development (IEA)

positive regulation of actin filament polymerization (ISO)

positive regulation of focal adhesion disassembly (ISO)

positive regulation of keratinocyte migration (ISO)

positive regulation of neuron projection development (IEA,ISO)

positive regulation of protein localization to plasma membrane (ISO)

positive regulation of protein secretion (ISO)

protein localization to cell surface (ISO)

protein localization to endosome (IBA,ISO,ISS)

protein localization to plasma membrane (IEA,ISO)

regulation of dendritic spine development (IBA,IMP,ISO)

regulation of filopodium assembly (ISO)

regulation of neuron projection development (ISO)

regulation of presynapse assembly (IDA,IMP)

regulation of Rac protein signal transduction (ISO)

ruffle assembly (ISO)

synaptic vesicle endocytosis (IDA,IMP)

vesicle-mediated transport (IBA)

Cellular Component

cell cortex (ISO)

cleavage furrow (ISO,ISS)

cytoplasm (ISO)

cytosol (ISO,ISS)

early endosome (IDA)

early endosome membrane (IEA)

endocytic vesicle (IBA,ISO,ISS)

endosome (ISO)

exocytic vesicle (ISO)

filopodium membrane (ISO)

Flemming body (ISO,ISS)

glutamatergic synapse (IDA,IMP)

Golgi apparatus (IEA)

membrane (ISO)

plasma membrane (ISO)

postsynapse (IDA)

presynapse (IDA)

recycling endosome (IDA)

recycling endosome membrane (IBA,ISO,ISS)

ruffle (IBA,IDA,ISO)

Molecular Function

G protein activity (ISO,ISS)

GDP binding (ISO,ISS)

GTP binding (IEA,ISO,ISS)

GTPase activity (IEA)

protein binding (ISO)

signaling adaptor activity (IEA,ISO)

thioesterase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

E-cadherin signaling pathway (ISO)

endocytosis pathway (IEA)

Fc gamma receptor mediated signaling pathway (IEA)

phosphatidylinositol 3-kinase class I signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ARF6 and EFA6A regulate the development and maintenance of dendritic spines.	Choi S, etal., J Neurosci. 2006 May 3;26(18):4811-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Regulation of dendritic development by the ARF exchange factor ARNO.	Hernandez-Deviez DJ, etal., Nat Neurosci 2002 Jul;5(7):623-4.
4.	GGA3 mediates TrkA endocytic recycling to promote sustained Akt phosphorylation and cell survival.	Li X, etal., Mol Biol Cell. 2015 Dec 1;26(24):4412-26. doi: 10.1091/mbc.E15-02-0087. Epub 2015 Oct 7.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	Antigen-stimulated activation of phospholipase D1b by Rac1, ARF6, and PKCalpha in RBL-2H3 cells.	Powner DJ, etal., Mol Biol Cell 2002 Apr;13(4):1252-62.
10.	Interspecies relationships among ADP-ribosylation factors (ARFs): evidence of evolutionary pressure to maintain individual identities.	Price SR, etal., Mol Cell Biochem 1996 Jun 7;159(1):15-23.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Arf6 regulates the cycling and the readily releasable pool of synaptic vesicles at hippocampal synapse.	Tagliatti E, etal., Elife. 2016 Jan 5;5. pii: e10116. doi: 10.7554/eLife.10116.
14.	Role of ARF6 in internalization of metal-binding proteins, metallothionein and transferrin, and cadmium-metallothionein toxicity in kidney proximal tubule cells.	Wolff NA, etal., Toxicol Appl Pharmacol. 2008 Jul 1;230(1):78-85. Epub 2008 Feb 20.

Additional References at PubMed

PMID:8947846	PMID:9312003	PMID:10022920	PMID:10036235	PMID:10913182	PMID:12477932	PMID:12584243	PMID:14684384	PMID:14978216	PMID:15509780	PMID:15980073	PMID:16100119
PMID:16325184	PMID:16439353	PMID:16751103	PMID:16880525	PMID:17398095	PMID:17634366	PMID:17897316	PMID:18504258	PMID:19124467	PMID:19622751	PMID:19666113	PMID:19686593
PMID:19845506	PMID:19946888	PMID:19948740	PMID:20080746	PMID:20458337	PMID:20682791	PMID:21276423	PMID:21423176	PMID:21499258	PMID:21825135	PMID:21951725	PMID:22344257
PMID:22836268	PMID:23376485	PMID:23533145	PMID:23572513	PMID:23603394	PMID:24392021	PMID:24469796	PMID:24600047	PMID:24616519	PMID:25490267	PMID:25605715	PMID:26019348
PMID:26824355	PMID:26884337	PMID:27044754	PMID:27330119	PMID:29420262	PMID:31206670	PMID:31907062

Genomics

Comparative Map Data

Arf6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	87,853,742 - 87,854,890 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	87,840,142 - 87,874,114 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	88,252,904 - 88,254,050 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	88,552,333 - 88,553,479 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	87,992,090 - 87,993,236 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	91,697,109 - 91,698,257 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	91,697,109 - 91,698,255 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	101,149,908 - 101,152,127 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	91,337,496 - 91,338,644 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	91,340,951 - 91,342,098 (+)	NCBI
Celera	6	86,351,473 - 86,352,621 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

ARF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	49,893,082 - 49,897,054 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	49,893,079 - 49,897,054 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	50,359,800 - 50,363,772 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	49,429,486 - 49,433,522 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	49,429,588 - 49,431,484	NCBI
Celera	14	30,226,871 - 30,230,907 (+)	NCBI		Celera
Cytogenetic Map	14	q21.3	NCBI
HuRef	14	30,484,292 - 30,488,326 (+)	NCBI		HuRef
CHM1_1	14	50,297,978 - 50,302,011 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	44,098,298 - 44,102,268 (+)	NCBI		T2T-CHM13v2.0

Arf6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	69,418,924 - 69,422,754 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	69,418,924 - 69,420,557 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	69,372,150 - 69,375,980 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	69,372,150 - 69,373,783 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	70,473,137 - 70,476,967 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	70,290,793 - 70,292,388 (+)	NCBI		MGSCv36	mm8
Celera	12	70,470,421 - 70,474,282 (+)	NCBI		Celera
Cytogenetic Map	12	C2	NCBI
cM Map	12	28.81	NCBI

Arf6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	12,817,496 - 12,818,023 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	12,814,814 - 12,818,142 (-)	NCBI	ChiLan1.0	ChiLan1.0

ARF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	14	50,244,617 - 50,249,869 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	30,482,191 - 30,486,741 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	48,788,586 - 48,792,641 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	48,789,329 - 48,789,856 (+)	Ensembl	panpan1.1		panPan2

ARF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	26,445,407 - 26,449,430 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	26,445,647 - 26,525,530 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	26,199,039 - 26,203,086 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	26,622,998 - 26,627,047 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	26,623,051 - 26,703,339 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	26,278,479 - 26,282,519 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	26,351,547 - 26,355,590 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	26,669,436 - 26,673,480 (+)	NCBI		UU_Cfam_GSD_1.0

Arf6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	58,503,422 - 58,507,422 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936583	181,490 - 185,471 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936583	181,490 - 185,466 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	179,713,299 - 179,717,841 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	179,697,582 - 179,717,299 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	200,071,305 - 200,075,268 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	26,948,794 - 26,952,803 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	26,949,388 - 26,950,074 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	15,277,536 - 15,281,551 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arf6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	18,882,690 - 18,883,217 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	18,880,065 - 18,883,456 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arf6
17 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	395
Count of miRNA genes:	208
Interacting mature miRNAs:	245
Transcripts:	ENSRNOT00000006355
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

Markers in Region

AW496366

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	87,854,468 - 87,854,581 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	91,697,836 - 91,697,948	NCBI	Rnor6.0
Rnor_5.0	6	101,151,155 - 101,151,267	UniSTS	Rnor5.0
RGSC_v3.4	6	91,338,223 - 91,338,335	UniSTS	RGSC3.4
Celera	6	86,352,200 - 86,352,312	UniSTS
Cytogenetic Map	6	q24	UniSTS

ARF6_719

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	87,853,899 - 87,854,765 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	91,697,267 - 91,698,132	NCBI	Rnor6.0
Rnor_5.0	6	101,150,586 - 101,151,451	UniSTS	Rnor5.0
RGSC_v3.4	6	91,337,654 - 91,338,519	UniSTS	RGSC3.4
Celera	6	86,351,631 - 86,352,496	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L12385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006355 ⟹ ENSRNOP00000006355

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,840,142 - 87,874,114 (+)	Ensembl
Rnor_6.0 Ensembl	6	91,697,109 - 91,698,255 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097511 ⟹ ENSRNOP00000079011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,852,374 - 87,857,232 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101767 ⟹ ENSRNOP00000077772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,840,679 - 87,857,061 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115929 ⟹ ENSRNOP00000080368

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	87,852,273 - 87,857,061 (+)	Ensembl

RefSeq Acc Id:

NM_024152 ⟹ NP_077066

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	87,853,742 - 87,854,890 (+)	NCBI
Rnor_6.0	6	91,697,109 - 91,698,257 (+)	NCBI
Rnor_5.0	6	101,149,908 - 101,152,127 (+)	NCBI
RGSC_v3.4	6	91,337,496 - 91,338,644 (+)	RGD
Celera	6	86,351,473 - 86,352,621 (+)	RGD

Sequence:

show sequence

CCCCTGCCCCTAGCAGGCAGCTTCGCGCAAGCCGGGCCGCAGGGCGTCCTCGCGGCGGGGCGGC
TACTTTTCGGGCTCGCAGCGGCGGCGGCGTTGTAGGCTGAGGGGACCCGGGACACCTGAATGCC
CCCGGCCCCGGCTCTTCCGACGCGATGGGGAAGGTGCTATCCAAGATCTTCGGGAACAAGGAAA
TGCGGATCCTCATGCTGGGCCTGGACGCAGCCGGCAAGACAACGATCCTGTACAAGTTGAAGCT
GGGCCAGTCTGTGACCACCATTCCCACGGTGGGTTTCAACGTGGAGACGGTGACTTACAAAAAC
GTCAAGTTCAACGTGTGGGATGTGGGCGGCCAGGACAAGATCCGGCCGCTCTGGCGGCATTACT
ACACCGGGACCCAGGGTCTGATCTTCGTGGTAGACTGCGCCGACCGCGACCGCATCGATGAGGC
CCGCCAGGAGCTGCACCGCATTATCAATGACCGGGAGATGAGGGACGCCATAATCCTCATCTTC
GCCAACAAGCAGGACCTGCCTGATGCCATGAAACCCCATGAGATCCAGGAGAAACTGGGCCTGA
CCCGGATTCGGGACAGGAACTGGTATGTGCAGCCCTCCTGTGCCACCTCCGGGGACGGACTCTA
TGAGGGGCTCACATGGTTAACCTCTAACTACAAATCCTAATGAGCGCCCTCCACCCAGCCCCCG
GAAGGAGAGAAATCAAAAACCCATTCATAGGATTATCGCCACCATCATCACCTCTTTCAATTGC
CACTCTCTTTTTTGAAACTGAACTCGAGTTACTGTTCTACCGTTTAGTGGGGTTGGGGGTTTTC
TTTGTTCCCCTTACCCCCCCTCTTCTATTTCCTTTCGGCTTTGCGTTAGGATGCTCTGATCTGA
CATTTGACACGAATACAGTGCTATATGCTCTTGTGACTTCCAGCAAACGGGGTGGGGTAATAGC
AACTCTTGGTAAAGTCCTTTATAATAATGGTTTTGATTTTTTTTTTTTATTTCGAGAGAATCTC
CCCCCATGTATGCCTTTTTCCTTTTTGCCCAGTTTCTTATCACTTGCTGTAGATGGCTTATTTT
GCATTCATGCAGACTATGTTCCAAGTCTGTTTCATCTAGTAAACTGAAAATTATTGCTTAAAAA
AAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077066	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40690	(Get FASTA)	NCBI Sequence Viewer
	AAH91146	(Get FASTA)	NCBI Sequence Viewer
	EDM03520	(Get FASTA)	NCBI Sequence Viewer
	P62332	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077066 ⟸ NM_024152
- UniProtKB:	Q5BKA5 (UniProtKB/Swiss-Prot), P62332 (UniProtKB/Swiss-Prot), A6HBW5 (UniProtKB/TrEMBL), A0A8L2Q237 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDV GGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPD AMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS hide sequence

RefSeq Acc Id:

ENSRNOP00000006355 ⟸ ENSRNOT00000006355

RefSeq Acc Id:

ENSRNOP00000080368 ⟸ ENSRNOT00000115929

RefSeq Acc Id:

ENSRNOP00000079011 ⟸ ENSRNOT00000097511

RefSeq Acc Id:

ENSRNOP00000077772 ⟸ ENSRNOT00000101767

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62332-F1-model_v2	AlphaFold	P62332	1-175	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621279	AgrOrtholog
BioCyc Gene	G2FUF-37246	BioCyc
Ensembl Genes	ENSRNOG00000004791	Ensembl
	ENSRNOG00000070951	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000006355.5	UniProtKB/TrEMBL
	ENSRNOP00000077772	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000079011	UniProtKB/Swiss-Prot
	ENSRNOP00000080368	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006355.6	UniProtKB/TrEMBL
	ENSRNOT00000097511	UniProtKB/Swiss-Prot
	ENSRNOT00000101767	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000115929	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7309902	IMAGE-MGC_LOAD
InterPro	Arf6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_ARF/SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79121	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108680	IMAGE-MGC_LOAD
NCBI Gene	79121	ENTREZGENE
PANTHER	ADP-RIBOSYLATION FACTOR 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11711	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Arf6	PhenoGen
PRINTS	SAR1GTPBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAB	UniProtKB/TrEMBL
SMART	ARF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q237	ENTREZGENE, UniProtKB/TrEMBL
	A6HBW5	ENTREZGENE, UniProtKB/TrEMBL
	ARF6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5BKA5	ENTREZGENE
UniProt Secondary	P26438	UniProtKB/Swiss-Prot
	Q5BKA5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Arf6	ADP-ribosylation factor 6			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Arf6	ADP-ribosylation factor 6			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	colocalized with phospholipase D1b to the plasma membrane, membrane ruffles, and intracellularly after antigen stimulation	727254
gene_expression	expressed in both embryonic and adult hippocampus	625544
gene_process	activates either Rac1 or phosphoinositide kinase pathway for regulation of dendritogenesis	625544
gene_process	may be involved in regulating dendritic branching	625544
gene_product	small GTPase family member	625544

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)