Advanced Search (OLGA)

Gene: Ltb4r2 (leukotriene B4 receptor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ltb4r2

Name:

leukotriene B4 receptor 2

RGD ID:

621029

Description:

Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in neuropeptide signaling pathway. Predicted to act upstream of or within keratinocyte migration and signal transduction. Predicted to be located in membrane and nucleoplasm. Predicted to be active in plasma membrane. Orthologous to human LTB4R2 (leukotriene B4 receptor 2); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LTB4 receptor JULF2; LTB4-R 2; LTB4-R2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LTB4R2 (leukotriene B4 receptor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Ltb4r2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ltb4r2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LTB4R2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ltb4r2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LTB4R2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LTB4R2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ltb4r2 (leukotriene B4 receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CIDEB (cell death inducing DFFA like effector b)	HGNC	PhylomeDB
Alliance orthologs ³
Mus musculus (house mouse):	Ltb4r2 (leukotriene B4 receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	LTB4R2 (leukotriene B4 receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ltb4r2b (leukotriene B4 receptor 2b)	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	ltb4r2a (leukotriene B4 receptor 2a)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ltb4r2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,228,634 - 33,230,453 (+)	NCBI		GRCr8
mRatBN7.2	15	29,258,712 - 29,260,531 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,259,240 - 29,260,316 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	31,104,925 - 31,106,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,252,131 - 32,253,207 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,494,484 - 30,495,560 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,446,478 - 34,448,220 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,446,878 - 34,447,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,335,390 - 38,336,466 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,923,472 - 33,924,548 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,939,171 - 33,940,248 (+)	NCBI
Celera	15	28,833,900 - 28,834,976 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	Acute Lung Injury	severity	ISO	RGD:732977	9068941	associated with Endotoxemia	RGD	PMID:27703200\|REF_RGD_ID:40903067

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	Brain-Lung-Thyroid Syndrome		ISO	RGD:1353949	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
Ltb4r2	Rat	lysinuric protein intolerance		ISO	RGD:1353949	8554872	ClinVar Annotator: match by term: Lysinuric protein intolerance	ClinVar	PMID:28492532
Ltb4r2	Rat	Specific Granule Deficiency		ISO	RGD:1353949	8554872	ClinVar Annotator: match by term: Specific granule deficiency	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	decreases expression	ISO	RGD:1353949	6480464	2,4,5,2',4',5'-hexachlorobiphenyl results in decreased expression of LTB4R2 mRNA	CTD	PMID:23146750
Ltb4r2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of LTB4R2 mRNA	CTD	PMID:27291303
Ltb4r2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1353949	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of LTB4R2 mRNA	CTD	PMID:23146750
Ltb4r2	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	ISO	RGD:1353949	6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of LTB4R2 mRNA	CTD	PMID:23146750
Ltb4r2	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:732977	6480464	bisphenol S results in decreased methylation of LTB4R2 exon	CTD	PMID:33297965
Ltb4r2	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:732977	6480464	bisphenol S affects the methylation of LTB4R2 gene	CTD	PMID:31683443
Ltb4r2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of LTB4R2 mRNA	CTD	PMID:16483693
Ltb4r2	Rat	aristolochic acid A	increases expression	ISO	RGD:1353949	6480464	aristolochic acid I results in increased expression of LTB4R2 mRNA	CTD	PMID:33212167
Ltb4r2	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1353949	6480464	Benzo(a)pyrene results in decreased methylation of LTB4R2 promoter	CTD	PMID:27901495
Ltb4r2	Rat	bisphenol A	decreases expression	ISO	RGD:1353949	6480464	bisphenol A results in decreased expression of LTB4R2 mRNA	CTD	PMID:23146750\|PMID:27685785
Ltb4r2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of LTB4R2 mRNA	CTD	PMID:30816183\|PMID:32528016
Ltb4r2	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of LTB4R2 mRNA	CTD	PMID:33453195
Ltb4r2	Rat	capsaicin	decreases expression	EXP		6480464	Capsaicin results in decreased expression of LTB4R2 mRNA	CTD	PMID:16278290
Ltb4r2	Rat	choline	multiple interactions	ISO	RGD:732977	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Ltb4r2	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of LTB4R2 mRNA	CTD	PMID:26033743
Ltb4r2	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of LTB4R2 mRNA	CTD	PMID:26033743
Ltb4r2	Rat	crocidolite asbestos	increases expression	ISO	RGD:732977	6480464	Asbestos, Crocidolite results in increased expression of LTB4R2 mRNA	CTD	PMID:29279043
Ltb4r2	Rat	cyclosporin A	decreases expression	ISO	RGD:732977	6480464	Cyclosporine results in decreased expression of LTB4R2 mRNA	CTD	PMID:19770486
Ltb4r2	Rat	cypermethrin	decreases expression	ISO	RGD:732977	6480464	cypermethrin results in decreased expression of LTB4R2 mRNA	CTD	PMID:29020013
Ltb4r2	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of LTB4R2 mRNA	CTD	PMID:23640034\|PMID:23914054
Ltb4r2	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1353949	6480464	di-n-butylphosphoric acid affects the expression of LTB4R2 mRNA	CTD	PMID:37042841
Ltb4r2	Rat	dimethylarsinic acid	multiple interactions	ISO	RGD:732977	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Ltb4r2	Rat	ethanol	multiple interactions	ISO	RGD:732977	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of LTB4R2 mRNA	CTD	PMID:30517762
Ltb4r2	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of LTB4R2 mRNA	CTD	PMID:18035473
Ltb4r2	Rat	folic acid	multiple interactions	ISO	RGD:732977	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Ltb4r2	Rat	L-methionine	multiple interactions	ISO	RGD:732977	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Ltb4r2	Rat	leukotriene B4	affects binding	ISO	RGD:1353949	6480464	Leukotriene B4 binds to LTB4R2 protein	CTD	PMID:11006272
Ltb4r2	Rat	leukotriene B5	affects binding	ISO	RGD:1353949	6480464	leukotriene B5 binds to LTB4R2 protein	CTD	PMID:11006272
Ltb4r2	Rat	mancozeb	increases expression	ISO	RGD:1353949	6480464	mancozeb results in increased expression of LTB4R2 mRNA	CTD	PMID:33396126
Ltb4r2	Rat	methylarsonic acid	multiple interactions	ISO	RGD:732977	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Ltb4r2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:732977	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of LTB4R2 mRNA	CTD	PMID:36331819
Ltb4r2	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:1353949	6480464	perfluorooctanoic acid results in decreased expression of LTB4R2 mRNA	CTD	PMID:23146750
Ltb4r2	Rat	pyridaben	decreases expression	ISO	RGD:732977	6480464	pyridaben results in decreased expression of LTB4R2 mRNA	CTD	PMID:22563483
Ltb4r2	Rat	resveratrol	multiple interactions	ISO	RGD:1353949	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of LTB4R2 mRNA	CTD	PMID:23557933
Ltb4r2	Rat	sodium arsenate	multiple interactions	ISO	RGD:732977	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Ltb4r2	Rat	sodium arsenite	multiple interactions	ISO	RGD:732977	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Ltb4r2	Rat	tetrachloromethane	multiple interactions	ISO	RGD:732977	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of LTB4R2 mRNA	CTD	PMID:30517762
Ltb4r2	Rat	titanium dioxide	increases methylation	ISO	RGD:732977	6480464	titanium dioxide results in increased methylation of LTB4R2 gene	CTD	PMID:35295148
Ltb4r2	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of LTB4R2 mRNA	CTD	PMID:33387578
Ltb4r2	Rat	triphenyl phosphate	affects expression	ISO	RGD:1353949	6480464	triphenyl phosphate affects the expression of LTB4R2 mRNA	CTD	PMID:37042841
Ltb4r2	Rat	triptonide	increases expression	ISO	RGD:732977	6480464	triptonide results in increased expression of LTB4R2 mRNA	CTD	PMID:33045310
Ltb4r2	Rat	valproic acid	affects expression	ISO	RGD:732977	6480464	Valproic Acid affects the expression of LTB4R2 mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ltb4r2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276\|InterPro:IPR003981\|InterPro:IPR003982	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ltb4r2	Rat	keratinocyte migration	acts_upstream_of_or_within	ISO	RGD:732977	1624291	PMID:15866883	RGD	PMID:15866883
Ltb4r2	Rat	keratinocyte migration	acts_upstream_of_or_within	IEA	UniProtKB:Q9JJL9\|ensembl:ENSMUSP00000048358	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ltb4r2	Rat	leukotriene signaling pathway	involved_in	IEA	GO:0001632	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Ltb4r2	Rat	leukotriene signaling pathway	involved_in	IEA	GO:0004974	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Ltb4r2	Rat	neuropeptide signaling pathway	involved_in	IBA	FB:FBgn0036278\|FB:FBgn0039595\|PANTHER:PTN000660491\|RGD:2658\|UniProtKB:O43603\|UniProtKB:O60755\|ZFIN:ZDB-GENE-140624-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ltb4r2	Rat	signal transduction	acts_upstream_of_or_within	ISO	RGD:732977	1624291	PMID:15866883	RGD	PMID:15866883
Ltb4r2	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ltb4r2	Rat	signal transduction	acts_upstream_of_or_within	IEA	UniProtKB:Q9JJL9\|ensembl:ENSMUSP00000048358	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ltb4r2	Rat	membrane	located_in	IEA	UniProtKB:Q9JJL9\|ensembl:ENSMUSP00000048358	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ltb4r2	Rat	membrane	located_in	IEA	InterPro:IPR000276\|InterPro:IPR003981\|InterPro:IPR003982\|InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ltb4r2	Rat	membrane	located_in	ISO	RGD:732977	1624291	PMID:15866883	RGD	PMID:15866883
Ltb4r2	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9NPC1\|ensembl:ENSP00000433290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ltb4r2	Rat	nucleoplasm	located_in	ISO	RGD:1353949	1624291		RGD	GO_REF:0000052
Ltb4r2	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0036278\|FB:FBgn0039595\|MGI:1926218\|PANTHER:PTN000660491\|UniProtKB:P47211\|UniProtKB:Q969F8\|UniProtKB:Q9NPC1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ltb4r2	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9NPC1\|ensembl:ENSP00000433290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ltb4r2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ltb4r2	Rat	plasma membrane	located_in	ISO	RGD:1353949	1624291		RGD	GO_REF:0000052
Ltb4r2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	G protein-coupled peptide receptor activity	enables	IBA	FB:FBgn0036278\|FB:FBgn0039595\|MGI:2148793\|MGI:2441827\|PANTHER:PTN000660491\|RGD:2656\|RGD:2657\|RGD:2658\|RGD:621884\|RGD:70930\|UniProtKB:O43603\|UniProtKB:O60755\|UniProtKB:P47211\|UniProtKB:Q969F8\|ZFIN:ZDB-GENE-060503-290\|ZFIN:ZDB-GENE-060526-54\|ZFIN:ZDB-GENE-070912-521\|ZFIN:ZDB-GENE-130603-37\|ZFIN:ZDB-GENE-131121-48\|ZFIN:ZDB-GENE-140624-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ltb4r2	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ltb4r2	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ltb4r2	Rat	leukotriene B4 receptor activity	enables	IBA	MGI:1309472\|MGI:1888501\|PANTHER:PTN001201185	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ltb4r2	Rat	leukotriene B4 receptor activity	enables	IEA	UniProtKB:Q9JJL9\|ensembl:ENSMUSP00000048358	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ltb4r2	Rat	leukotriene B4 receptor activity	enables	ISO	RGD:732977	1624291	PMID:15866883	RGD	PMID:15866883
Ltb4r2	Rat	leukotriene receptor activity	enables	IEA	ARBA:ARBA00029248	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ltb4r2	Rat	leukotriene receptor activity	enables	IEA	InterPro:IPR003981\|InterPro:IPR003982	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ltb4r2	Rat	calcium/calcium-mediated signaling pathway		IEA		6907045		KEGG	rno:04020

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10889186	PMID:15866883	PMID:19946888	PMID:21189570

Ltb4r2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,228,634 - 33,230,453 (+)	NCBI		GRCr8
mRatBN7.2	15	29,258,712 - 29,260,531 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,259,240 - 29,260,316 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	31,104,925 - 31,106,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,252,131 - 32,253,207 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,494,484 - 30,495,560 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,446,478 - 34,448,220 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,446,878 - 34,447,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,335,390 - 38,336,466 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,923,472 - 33,924,548 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,939,171 - 33,940,248 (+)	NCBI
Celera	15	28,833,900 - 28,834,976 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

LTB4R2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,310,140 - 24,312,038 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,305,734 - 24,312,053 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	24,779,346 - 24,781,244 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,848,001 - 23,850,798 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	23,848,000 - 23,850,798	NCBI
Celera	14	4,643,986 - 4,645,888 (+)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,894,524 - 4,896,426 (+)	NCBI		HuRef
CHM1_1	14	24,777,957 - 24,779,859 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,508,483 - 18,510,381 (+)	NCBI		T2T-CHM13v2.0

Ltb4r2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,995,379 - 56,001,523 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,998,885 - 56,002,595 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	55,757,922 - 55,764,066 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,761,428 - 55,765,138 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	56,380,761 - 56,381,843 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,715,995 - 54,717,077 (+)	NCBI		MGSCv36	mm8
Celera	14	53,566,960 - 53,568,042 (+)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Ltb4r2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	35,989,425 - 35,991,492 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	35,989,425 - 35,991,492 (-)	NCBI	ChiLan1.0	ChiLan1.0

LTB4R2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,278,047 - 4,282,326 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,280,869 - 4,281,948 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,199,538 - 4,206,302 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,388,676 - 4,392,789 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,391,671 - 4,392,750 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,079,024 - 4,083,137 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,140,847 - 4,144,961 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,403,431 - 4,407,545 (+)	NCBI		UU_Cfam_GSD_1.0

Ltb4r2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	36,146,927 - 36,149,192 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936722	239,811 - 242,050 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LTB4R2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	74,978,876 - 74,983,768 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	74,978,871 - 74,983,811 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,249,814 - 80,254,577 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LTB4R2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,292,283 - 1,298,723 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,293,587 - 1,294,756 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666036	12,976,846 - 12,979,595 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ltb4r2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,192,441 - 8,196,375 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624820	8,192,441 - 8,196,472 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ltb4r2
1 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	170
Count of miRNA genes:	127
Interacting mature miRNAs:	137
Transcripts:	ENSRNOT00000027619
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	4	12	53	32	35	9	17	9	6	77	44	36	16	26	26


RefSeq Transcripts	NM_053640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB052660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC116083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027619 ⟹ ENSRNOP00000027619

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,259,240 - 29,260,316 (+)	Ensembl
Rnor_6.0 Ensembl	15	34,446,878 - 34,447,954 (+)	Ensembl

RefSeq Acc Id:

NM_053640 ⟹ NP_446092

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,228,634 - 33,230,453 (+)	NCBI
mRatBN7.2	15	29,258,712 - 29,260,531 (+)	NCBI
Rnor_6.0	15	34,446,878 - 34,447,954 (+)	NCBI
Rnor_5.0	15	38,335,390 - 38,336,466 (+)	NCBI
RGSC_v3.4	15	33,923,472 - 33,924,548 (+)	RGD
Celera	15	28,833,900 - 28,834,976 (+)	RGD

Sequence:

show sequence

ATGTCTGTCTGCTACCGTCCGCCTGGGAATGAGACGCTGCTGAGTTGGAAGGGCTCGCGGGCCACCGGCACTGCCTTTCTCCTGCTGGCGGCGTTGCTGGGACTGCCAGGCAATGGCTTCGTAGTGTG
GAGCTTGGCGGGCTGGCGGCCCACCGCCGGGCGGCCACTAGCAGCCACACTTGTGCTGCATCTGGCGCTAGCCGACGGCGCGGTGCTGCTGCTCACGCCGCTCTTTGTGGCCTTCCTGAGCCGACAGG
CTTGGCCCCTGGGCCAGGTGGGCTGCAAGGCAGTGTACTACGTGTGCGCGCTCAGCATGTACGCCAGCGTGCTGCTCACCGGCCTGCTCAGCCTGCAGCGCTGTCTAGCGGTCACTCGGCCTTTCCTG
GCTCCCCGACTTCGCAGCCCGGCCCTGGCCCGCCGCCTGCTGCTGGGGGTCTGGCTGGCCGCCCTGGTGCTCGCCGTCCCGGCCGCGGTCTACCGCCACCTCTGGGGTGATCGCGTGTGTCAATTGTG
CCACCCATCGGCCGTGCACGCTGCAGCTCATCTGAGCCTGGAGACCCTGACTGCCTTCGTCCTGCCTTTTGGGACCGTGCTCGGCTGCTACGGCGTGACGCTGGCGCGGTTGCGGGGAGCGCGCTGGG
GCTCGGGGCGACAAGGCACGCGGGTGGGTCGTCTGGTGAGCGCCATCGTACTGGCCTTTGGCTTGCTCTGGGCCCCCTACCACGCGGTCAATCTCCTACAGGCGGTGGCCGCGCTCGCTCCGCCGGAA
GGACCCCTAGCCAGGCTCGGTGGGGCGGGCCAGGCAGCGCGCGCTGGAACTACAGCCTTGGCTTTCTTTAGTTCCAGCGTCAACCCGGTGCTCTACGTCTTTACTGCGGGTGATTTGCTGCCGCGGGC
GGGGCCTCGGTTCCTCACTCGACTCTTCGAAGGCTCTGGGGAGGCCCGAGTAGGCAGCCGCTCTAGGGAGGGTACCATGGAGCTCCGAACTACCCCCAGGCTGAAAGTAGTGGGTCAGGGCAGGGGCT
ATGGAGACCCTGGAGGTGGGGGCAGGATGGAGAAAGACAGTCAGGAATGGTAG

hide sequence


Protein RefSeqs	NP_446092	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB60815	(Get FASTA)	NCBI Sequence Viewer
	EDM14280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027619
	ENSRNOP00000027619.1
GenBank Protein	Q924U0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446092 ⟸ NM_053640

- UniProtKB:

Q924U0 (UniProtKB/Swiss-Prot), A6KH51 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSVCYRPPGNETLLSWKGSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPTAGRPLAATLVLHLALADGAVLLLTPLFVAFLSRQAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFL
APRLRSPALARRLLLGVWLAALVLAVPAAVYRHLWGDRVCQLCHPSAVHAAAHLSLETLTAFVLPFGTVLGCYGVTLARLRGARWGSGRQGTRVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPE
GPLARLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARVGSRSREGTMELRTTPRLKVVGQGRGYGDPGGGGRMEKDSQEW

hide sequence

Ensembl Acc Id:

ENSRNOP00000027619 ⟸ ENSRNOT00000027619

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q924U0-F1-model_v2	AlphaFold	Q924U0	1-358	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-13690	BioCyc
Ensembl Genes	ENSRNOG00000020382	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027619	ENTREZGENE
	ENSRNOT00000027619.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Leukotriene_B4_rcpt	UniProtKB/Swiss-Prot
	Leukotriene_B4_typ-2_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:114098	UniProtKB/Swiss-Prot
NCBI Gene	114098	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	LEUKOTRIENE B4 RECEPTOR 2	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Ltb4r2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	LTB2RECEPTOR	UniProtKB/Swiss-Prot
	LTBRECEPTOR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020382	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6KH51	ENTREZGENE, UniProtKB/TrEMBL
	LT4R2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Ltb4r2	leukotriene B4 receptor 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ltb4r2	leukotriene B4 receptor 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)