Advanced Search (OLGA)

Gene: Gemin2 (gem (nuclear organelle) associated protein 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gemin2

Name:

gem (nuclear organelle) associated protein 2

RGD ID:

620842

Description:

Predicted to be involved in spliceosomal snRNP assembly. Predicted to be located in Gemini of Cajal bodies; cytosol; and nucleolus. Predicted to be part of SMN complex. Predicted to be active in nucleus. Orthologous to human GEMIN2 (gem nuclear organelle associated protein 2); INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

component of gems 2; gem-associated protein 2; gemin-2; MGC112609; Sip1; SMN interacting protein-1; SMN-interacting protein 1; survival of motor neuron protein interacting protein 1; survival of motor neuron protein-interacting protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI		GRCr8
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	77,159,729 - 77,173,899 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	77,459,052 - 77,473,222 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	76,886,529 - 76,900,699 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	79,711,444 - 79,725,094 (+)	NCBI
Celera	6	75,467,807 - 75,481,438 (+)	NCBI		Celera
Cytogenetic Map	6	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gemin2	Rat	Brain-Lung-Thyroid Syndrome		ISO	GEMIN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gemin2	Rat	1,2,4-trimethylbenzene	decreases expression	EXP		6480464	pseudocumene results in decreased expression of GEMIN2 protein	CTD	PMID:17337753
Gemin2	Rat	17alpha-ethynylestradiol	affects expression	ISO	Gemin2 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of GEMIN2 mRNA	CTD	PMID:17555576
Gemin2	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Gemin2 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GEMIN2 mRNA	CTD	PMID:17942748
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Gemin2 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GEMIN2 mRNA	CTD	PMID:17942748
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GEMIN2 mRNA	CTD	PMID:33387578
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Gemin2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of GEMIN2 mRNA	CTD	PMID:31961203
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of GEMIN2 mRNA	CTD	PMID:20106945 and PMID:21632981
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gemin2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GEMIN2 mRNA	CTD	PMID:21570461
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of GEMIN2 mRNA]	CTD	PMID:21215274
Gemin2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of GEMIN2 mRNA	CTD	PMID:21215274
Gemin2	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of GEMIN2 mRNA	CTD	PMID:21346803
Gemin2	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Gemin2 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of GEMIN2 mRNA	CTD	PMID:18648102
Gemin2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of GEMIN2 mRNA	CTD	PMID:30047161
Gemin2	Rat	aflatoxin B1	increases methylation	ISO	GEMIN2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of GEMIN2 intron	CTD	PMID:30157460
Gemin2	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of GEMIN2 mRNA	CTD	PMID:30047161
Gemin2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of GEMIN2 mRNA	CTD	PMID:16483693
Gemin2	Rat	arsenite(3-)	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to GEMIN2 mRNA]	CTD	PMID:32406909
Gemin2	Rat	benzo[a]pyrene	increases expression	ISO	Gemin2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of GEMIN2 mRNA	CTD	PMID:22228805
Gemin2	Rat	benzo[a]pyrene	affects methylation	ISO	GEMIN2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of GEMIN2 intron	CTD	PMID:30157460
Gemin2	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Gemin2	Rat	beta-lapachone	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of GEMIN2 mRNA	CTD	PMID:38218311
Gemin2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of GEMIN2 mRNA	CTD	PMID:25181051
Gemin2	Rat	bisphenol A	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of GEMIN2 mRNA	CTD	PMID:29275510
Gemin2	Rat	cadmium dichloride	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of GEMIN2 mRNA	CTD	PMID:38382870 and PMID:38568856
Gemin2	Rat	calcitriol	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Calcitriol results in decreased expression of GEMIN2 mRNA	CTD	PMID:21592394
Gemin2	Rat	calcitriol	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of GEMIN2 mRNA	CTD	PMID:21592394
Gemin2	Rat	cisplatin	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of GEMIN2 mRNA	CTD	PMID:30871063
Gemin2	Rat	copper(II) sulfate	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of GEMIN2 mRNA	CTD	PMID:19549813
Gemin2	Rat	coumestrol	increases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Coumestrol results in increased expression of GEMIN2 mRNA	CTD	PMID:19167446
Gemin2	Rat	coumestrol	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of GEMIN2 mRNA	CTD	PMID:19167446
Gemin2	Rat	cylindrospermopsin	increases expression	ISO	GEMIN2 (Homo sapiens)	6480464	cylindrospermopsin results in increased expression of GEMIN2 mRNA	CTD	PMID:24921660
Gemin2	Rat	Dibutyl phosphate	affects expression	ISO	GEMIN2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GEMIN2 mRNA	CTD	PMID:37042841
Gemin2	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of GEMIN2 mRNA	CTD	PMID:21266533
Gemin2	Rat	dicrotophos	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	dicrotophos results in decreased expression of GEMIN2 mRNA	CTD	PMID:28302478
Gemin2	Rat	Enterolactone	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of GEMIN2 mRNA	CTD	PMID:19167446
Gemin2	Rat	enzyme inhibitor	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of GEMIN2 protein	CTD	PMID:23301498
Gemin2	Rat	ethanol	increases expression	ISO	Gemin2 (Mus musculus)	6480464	Ethanol results in increased expression of GEMIN2 mRNA	CTD	PMID:30319688
Gemin2	Rat	formaldehyde	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of GEMIN2 mRNA	CTD	PMID:23649840
Gemin2	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of GEMIN2 mRNA	CTD	PMID:30047161
Gemin2	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of GEMIN2 mRNA	CTD	PMID:25729387
Gemin2	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of GEMIN2 mRNA	CTD	PMID:25729387
Gemin2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of GEMIN2 mRNA	CTD	PMID:33387578
Gemin2	Rat	phenobarbital	affects expression	ISO	GEMIN2 (Homo sapiens)	6480464	Phenobarbital affects the expression of GEMIN2 mRNA	CTD	PMID:19159669
Gemin2	Rat	pirinixic acid	increases expression	ISO	Gemin2 (Mus musculus)	6480464	pirinixic acid results in increased expression of GEMIN2 mRNA	CTD	PMID:18301758 and PMID:23811191
Gemin2	Rat	quercetin	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Quercetin results in decreased expression of GEMIN2 mRNA	CTD	PMID:21632981
Gemin2	Rat	resveratrol	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of GEMIN2 mRNA	CTD	PMID:23557933
Gemin2	Rat	sodium arsenite	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of GEMIN2 mRNA	CTD	PMID:38568856
Gemin2	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of GEMIN2 mRNA	CTD	PMID:30047161
Gemin2	Rat	tamoxifen	affects expression	ISO	Gemin2 (Mus musculus)	6480464	Tamoxifen affects the expression of GEMIN2 mRNA	CTD	PMID:17555576
Gemin2	Rat	testosterone	decreases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Testosterone results in decreased expression of GEMIN2 mRNA	CTD	PMID:21592394
Gemin2	Rat	testosterone	multiple interactions	ISO	GEMIN2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of GEMIN2 mRNA	CTD	PMID:21592394
Gemin2	Rat	tetrachloromethane	decreases expression	ISO	Gemin2 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of GEMIN2 mRNA	CTD	PMID:31919559
Gemin2	Rat	thalidomide	decreases expression	ISO	Gemin2 (Mus musculus)	6480464	Thalidomide results in decreased expression of GEMIN2 mRNA	CTD	PMID:26217789
Gemin2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of GEMIN2 mRNA	CTD	PMID:34492290
Gemin2	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of GEMIN2 mRNA	CTD	PMID:25729387
Gemin2	Rat	triadimefon	decreases expression	EXP		6480464	triadimefon results in decreased expression of GEMIN2 mRNA	CTD	PMID:30047161
Gemin2	Rat	valproic acid	increases expression	ISO	GEMIN2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of GEMIN2 mRNA	CTD	PMID:29154799
Gemin2	Rat	vorinostat	increases expression	ISO	GEMIN2 (Homo sapiens)	6480464	vorinostat results in increased expression of GEMIN2 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gemin2	Rat	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gemin2	Rat	RNA splicing	involved_in	IEA	UniProtKB-KW:KW-0508	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gemin2	Rat	spliceosomal complex assembly	involved_in	IEA	InterPro:IPR017364	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gemin2	Rat	spliceosomal snRNP assembly	involved_in	ISS	UniProtKB:O14893	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Gemin2	Rat	spliceosomal snRNP assembly	involved_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	spliceosomal snRNP assembly	involved_in	IEA	InterPro:IPR017364 and InterPro:IPR035426	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gemin2	Rat	spliceosomal snRNP assembly	involved_in	IBA	FB:FBgn0036850 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gemin2	Rat	spliceosomal snRNP assembly	involved_in	ISO	GEMIN2 (Homo sapiens)	1624291	PMID:12067652 more ...	RGD	PMID:12067652 more ...

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gemin2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gemin2	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9CQQ4 and ensembl:ENSMUSP00000021379	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	cytoplasm	located_in	ISO	Gemin2 (Mus musculus)	1624291	PMID:11181573	RGD	PMID:11181573
Gemin2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gemin2	Rat	cytosol	located_in	ISS	UniProtKB:O14893	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Gemin2	Rat	cytosol	located_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	cytosol	located_in	ISO	GEMIN2 (Homo sapiens)	1624291	PMID:18984161	RGD	PMID:18984161
Gemin2	Rat	Gemini of Cajal bodies	located_in	ISS	UniProtKB:O14893	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Gemin2	Rat	Gemini of Cajal bodies	located_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	Gemini of Cajal bodies	located_in	IEA	UniProtKB-SubCell:SL-0127	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gemin2	Rat	Gemini of Cajal bodies	located_in	ISO	GEMIN2 (Homo sapiens)	1624291	PMID:20513430	RGD	PMID:20513430
Gemin2	Rat	nuclear body	located_in	ISO	GEMIN2 (Homo sapiens) and UniProtKB:O14893-5	1624291		RGD	GO_REF:0000052
Gemin2	Rat	nuclear body	located_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	nucleolus	located_in	ISO	GEMIN2 (Homo sapiens) and UniProtKB:O14893-5	1624291		RGD	GO_REF:0000052
Gemin2	Rat	nucleolus	located_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	nucleoplasm	located_in	ISO	GEMIN2 (Homo sapiens) and UniProtKB:O14893-5	1624291		RGD	GO_REF:0000052
Gemin2	Rat	nucleoplasm	located_in	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	nucleus	is_active_in	IBA	FB:FBgn0036850 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gemin2	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gemin2	Rat	nucleus	located_in	IEA	UniProtKB:Q9CQQ4 and ensembl:ENSMUSP00000021379	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	nucleus	located_in	ISO	Gemin2 (Mus musculus)	1624291	PMID:11181573	RGD	PMID:11181573
Gemin2	Rat	SMN complex	part_of	ISS	UniProtKB:O14893	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Gemin2	Rat	SMN complex	part_of	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	SMN complex	part_of	IBA	FB:FBgn0036850 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gemin2	Rat	SMN complex	part_of	ISO	GEMIN2 (Homo sapiens)	1624291	PMID:17178713 and PMID:18984161	RGD	PMID:17178713 and PMID:18984161
Gemin2	Rat	SMN-Sm protein complex	part_of	ISS	UniProtKB:O14893	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Gemin2	Rat	SMN-Sm protein complex	part_of	IEA	UniProtKB:O14893 and ensembl:ENSP00000308533	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gemin2	Rat	SMN-Sm protein complex	part_of	ISO	GEMIN2 (Homo sapiens)	1624291	PMID:18984161	RGD	PMID:18984161
Gemin2	Rat	spliceosomal complex	part_of	IEA	InterPro:IPR017364	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gemin2	Rat	protein binding	enables	ISO	GEMIN2 (Homo sapiens)	1624291	UniProtKB:O60684 more ...	RGD	PMID:10500148 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Information Derived from GenBank Report	RGD, Sept. 2003

PMID:11181573	PMID:12477932	PMID:18255031	PMID:18984161	PMID:20513430	PMID:23319195

Gemin2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI		GRCr8
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	77,159,729 - 77,173,899 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	77,459,052 - 77,473,222 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	76,886,529 - 76,900,699 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	79,711,444 - 79,725,094 (+)	NCBI
Celera	6	75,467,807 - 75,481,438 (+)	NCBI		Celera
Cytogenetic Map	6	q23	NCBI

GEMIN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	39,114,323 - 39,136,973 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	39,114,285 - 39,136,973 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	39,583,527 - 39,606,177 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	38,653,239 - 38,675,928 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	38,653,238 - 38,675,926	NCBI
Celera	14	19,448,115 - 19,470,806 (+)	NCBI		Celera
Cytogenetic Map	14	q21.1	NCBI
HuRef	14	19,697,826 - 19,720,403 (+)	NCBI		HuRef
CHM1_1	14	39,582,090 - 39,604,781 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	33,303,000 - 33,325,655 (+)	NCBI		T2T-CHM13v2.0

Gemin2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	59,060,177 - 59,075,256 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	59,060,179 - 59,075,256 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	59,013,391 - 59,028,470 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	59,013,393 - 59,028,470 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	60,114,380 - 60,128,975 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	59,931,403 - 59,946,480 (+)	NCBI		MGSCv36	mm8
Celera	12	60,176,663 - 60,191,255 (+)	NCBI		Celera
Cytogenetic Map	12	C1	NCBI
cM Map	12	25.99	NCBI

Gemin2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	22,142,078 - 22,153,698 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	22,142,082 - 22,153,699 (-)	NCBI	ChiLan1.0	ChiLan1.0

GEMIN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	40,446,187 - 40,470,073 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	39,662,696 - 39,686,587 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	19,884,100 - 19,906,823 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	38,240,343 - 38,262,370 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	38,240,379 - 38,261,925 (+)	Ensembl	panpan1.1		panPan2

GEMIN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	17,305,884 - 17,328,698 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	17,305,907 - 17,328,582 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	17,117,065 - 17,139,877 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	17,428,117 - 17,450,935 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	17,428,138 - 17,452,018 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	17,115,718 - 17,138,520 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	17,187,396 - 17,210,186 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	17,473,998 - 17,496,784 (+)	NCBI		UU_Cfam_GSD_1.0

Gemin2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	49,211,834 - 49,230,122 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936494	12,717,268 - 12,740,193 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936494	12,717,358 - 12,737,019 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GEMIN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	169,676,156 - 169,701,481 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	169,676,152 - 169,701,475 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	188,436,304 - 188,461,158 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GEMIN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	15,886,441 - 15,909,137 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666053	4,929,914 - 4,952,589 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gemin2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	8,577,158 - 8,593,625 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624813	8,577,291 - 8,593,625 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gemin2
58 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
6	89634820	89634821	A	T	snv	RCS/Kyo (KyushuU), KFRS3B/Kyo (KyushuU)	View more Information
6	89634823	89634824	A	T	snv	RCS/Kyo (KyushuU), KFRS3B/Kyo (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	36
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000006137
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	38783989	83783989	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	35230417	80230417	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72227641	81132889	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	33309549	81132889	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	34434137	77102317	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat

RH133890

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	82,455,855 - 82,456,045 (+)	Marker Load Pipeline
mRatBN7.2	6	76,720,959 - 76,721,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	80,122,188 - 80,122,377	NCBI	Rnor6.0
Rnor_5.0	6	89,648,060 - 89,648,249	UniSTS	Rnor5.0
RGSC_v3.4	6	79,721,850 - 79,722,039	UniSTS	RGSC3.4
Celera	6	75,481,244 - 75,481,433	UniSTS
RH 3.4 Map	6	545.6	UniSTS
Cytogenetic Map	6	q23	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_053389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039113002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039113003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005505592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC079389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF176072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006137 ⟹ ENSRNOP00000006137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	76,707,523 - 76,721,153 (+)	Ensembl
Rnor_6.0 Ensembl	6	80,108,655 - 80,122,365 (+)	Ensembl

RefSeq Acc Id:

NM_053389 ⟹ NP_445841

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,419 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,523 - 76,721,154 (+)	NCBI
Rnor_6.0	6	80,108,751 - 80,122,382 (+)	NCBI
Rnor_5.0	6	89,634,623 - 89,648,254 (+)	NCBI
RGSC_v3.4	6	79,708,413 - 79,722,044 (+)	RGD
Celera	6	75,467,807 - 75,481,438 (+)	RGD

Sequence:

show sequence

GCGACGGAGGGCGCTTGAGCGCCTGCGCGGTACCTACCTTGGGTACAGGCGCCAATAGAGACTGGCGGGAGTAAATACCATGGCGTGGGTTCCAGCCGAGTCTGCGGTGGAAGAGTTGATGCCACGGT
TGTTACCTGTGGAGCCCTGTGACTTGACGGAAGGTTTCGATCCCTCGGTACCCCCCAGGACGCCTCAGGAATACCTGAGGAGGGTGCAGATCGAAGCAGCCCAGTGTCCAGATGTTGTGGTAGCCCAG
ATTGACCCAAAGAAGTTGAAAAGGAAGCAAAGTGTGAATGTTTCTCTTTCGGGATGCCACCCTGCCCCTGAAGGTTATTCCCCAACACTGCAGTGGCAGCAGCAACAAGTGATACAGTTTTCGAGTGT
TCGACAGAGTGTGCACAAGCATAGAAATCACTGGAAATCTCAACAGTTGGATAGTAATGTGACAATGCCAAAATCTGAAGATGAAGAAGGCTGGAAAAAATTTTGTCTGGGTGAAAGATTATGTGCTG
AAGGGGCTACTGGACCATCTACAGACGAAAGCCCTGGGATTGATTATGTACAAGTTGGTTTTCCTCCCTTGCTGAGTATTGTAAGCAGAATGAATCAGGCAACCATTACTAGTGTCTTGGAATATCTA
AGTAATTGGTTTGGAGAAAGAGATTTTACTCCAGAATTGGGAAGATGGTTCTATGCTTTGTTGGCTTGTCTTGAGAAACCTTTGCTACCTGAGGCTCACTCACTGATTCGACAGCTTGCCAGAAGGTG
TTCTGAAGTGAGGCTCCTGGTGGGCAGTAAAGACGATGAAAGAGTTCCAGCTTTGAATCTGCTGATCTGCTTAGTTAGCAGGTATTTTGATCAACGTGATTTAGCTGATGAGCCATCTTGATAGAGCT
TACCTCCTGGGGATGGAAGAGAGTTCTGTGAAGGGAGCCTAAGTCTGAGGAAGCATAATTCCAACCTGAGGACAGAGTGCATCACTTCTTCAAGTTGTGTGAAGGGTTTCATCTTAATCTGCAATTCA
AGTTGATATTCAAAATATAGACTTGATTGGTTTAAGTGTCTGAAATGTCTACGGAAAGCCCACCTGGCATCTGATGAGCAGTTGGAACAGTTTTCCTCAGTTGCATGCATTGAAAATAGGCCACGTGG
GACTTAGTACTTAAGCGGCTTGCATAAAAACTGCTGACATTTTATACAGTCCCCTGGTGCTGCTTCATTGGTTTTTTACAATATACATATATATTTATGTTGAAATGTATTTTGACTACTCAAATTTT
ACTTGACTCAAACAAAATAAAAGACAATGGATGTCCTTAGAGTTGCAATTCAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039113002 ⟹ XP_038968930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,576 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,526 - 76,721,154 (+)	NCBI

RefSeq Acc Id:

XM_039113003 ⟹ XP_038968931

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,441 - 82,456,050 (+)	NCBI
mRatBN7.2	6	76,707,529 - 76,721,154 (+)	NCBI

RefSeq Acc Id:

XR_005505592

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	82,442,498 - 82,452,209 (+)	NCBI
mRatBN7.2	6	76,706,424 - 76,721,154 (+)	NCBI


Protein RefSeqs	NP_445841	(Get FASTA)	NCBI Sequence Viewer
	XP_038968930	(Get FASTA)	NCBI Sequence Viewer
	XP_038968931	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD53287	(Get FASTA)	NCBI Sequence Viewer
	AAH98662	(Get FASTA)	NCBI Sequence Viewer
	EDM03464	(Get FASTA)	NCBI Sequence Viewer
	EDM03465	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006137
	ENSRNOP00000006137.4
GenBank Protein	Q9QZP1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445841 ⟸ NM_053389

- UniProtKB:

Q4G084 (UniProtKB/Swiss-Prot), Q9QZP1 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNVSLSGCHPAPEGYSPTLQWQQQQVIQFSSVRQSVHKHRNHWKSQQLDSNVTMPKSE
DEEGWKKFCLGERLCAEGATGPSTDESPGIDYVQVGFPPLLSIVSRMNQATITSVLEYLSNWFGERDFTPELGRWFYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVGSKDDERVPALNLLICLVS
RYFDQRDLADEPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000006137 ⟸ ENSRNOT00000006137

RefSeq Acc Id:	XP_038968930 ⟸ XM_039113002
- Peptide Label:	isoform X1
- UniProtKB:	A6HBQ9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038968931 ⟸ XM_039113003
- Peptide Label:	isoform X1
- UniProtKB:	A6HBQ9 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZP1-F1-model_v2	AlphaFold	Q9QZP1	1-269	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694614

Promoter ID:

EPDNEW_R5139

Type:

initiation region

Name:

Gemin2_1

Description:

gem associated protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	80,108,728 - 80,108,788	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-37388	BioCyc
Ensembl Genes	ENSRNOG00000004360	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006137	ENTREZGENE
	ENSRNOT00000006137.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.220	UniProtKB/Swiss-Prot
	1.20.58.1070	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7386123	IMAGE-MGC_LOAD
InterPro	GEMIN2	UniProtKB/Swiss-Prot
	Gemin2/Brr1	UniProtKB/Swiss-Prot
KEGG Report	rno:84404	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112609	IMAGE-MGC_LOAD
NCBI Gene	84404	ENTREZGENE
PANTHER	GEM-ASSOCIATED PROTEIN 2	UniProtKB/Swiss-Prot
	GEMIN2	UniProtKB/Swiss-Prot
Pfam	SIP1	UniProtKB/Swiss-Prot
PhenoGen	Gemin2	PhenoGen
PIRSF	SMN_Gemin2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004360	RatGTEx
UniProt	A6HBQ9	ENTREZGENE, UniProtKB/TrEMBL
	GEMI2_RAT	UniProtKB/Swiss-Prot
	Q4G084	ENTREZGENE
	Q9QZP1	ENTREZGENE
UniProt Secondary	Q4G084	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-18	Gemin2	gem (nuclear organelle) associated protein 2	Sip1	survival of motor neuron protein interacting protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Sip1	survival of motor neuron protein interacting protein 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Sip1	survival of motor neuron protein interacting protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar