Symbol:
Pdyn
Name:
prodynorphin
RGD ID:
62054
Description:
Predicted to enable opioid receptor binding activity. Involved in response to immobilization stress and response to nicotine. Located in several cellular components, including dendritic spine; dense core granule; and neuronal cell body. Is active in neuronal dense core vesicle lumen and synaptic vesicle. Used to study depressive disorder. Biomarker of several diseases, including alcohol use disorder; amphetamine abuse; brain disease (multiple); cocaine abuse; and morphine dependence. Human ortholog(s) of this gene implicated in several diseases, including alcohol dependence; alcohol use disorder; amphetamine abuse; drug dependence (multiple); and spinocerebellar ataxia type 23. Orthologous to human PDYN (prodynorphin); INTERACTS WITH (R,R)-tramadol; (S)-amphetamine; 1,3-dinitrobenzene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
beta-neoendorphin-dynorphin; preprodynorphin; proenkephalin B; proenkephalin-B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDYN (prodynorphin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pdyn (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdyn (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDYN (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDYN (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdyn (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDYN (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDYN (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdyn (prodynorphin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pdyn (prodynorphin)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PDYN (prodynorphin)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdyn (prodynorphin)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 137,354,161 - 137,366,503 (-) NCBI GRCr8 mRatBN7.2 3 116,900,990 - 116,913,334 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 116,900,992 - 116,913,334 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 120,798,229 - 120,810,577 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 129,393,853 - 129,406,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 127,054,324 - 127,066,672 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 122,194,327 - 122,206,671 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 122,194,329 - 122,206,671 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 127,809,688 - 127,822,296 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 117,291,025 - 117,303,367 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 117,196,597 - 117,208,923 (-) NCBI Celera 3 115,716,443 - 115,728,785 (-) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdyn Rat (R,R)-tramadol decreases expression EXP 6480464 Tramadol results in decreased expression of PDYN mRNA CTD PMID:17401159 Pdyn Rat (S)-amphetamine increases expression ISO Pdyn (Mus musculus) 6480464 Dextroamphetamine results in increased expression of PDYN mRNA CTD PMID:11566502 and PMID:18681898 Pdyn Rat (S)-amphetamine increases expression EXP 6480464 Dextroamphetamine results in increased expression of PDYN mRNA CTD PMID:11532335 more ... Pdyn Rat (S)-amphetamine multiple interactions EXP 6480464 LY 306740 inhibits the reaction [Dextroamphetamine results in increased expression of PDYN mRNA] more ... CTD PMID:11532335 more ... Pdyn Rat (S)-amphetamine multiple interactions ISO Pdyn (Mus musculus) 6480464 GRM1 protein affects the reaction [Dextroamphetamine results in increased expression of PDYN mRNA] CTD PMID:11566502 Pdyn Rat 1,2-dimethylhydrazine multiple interactions ISO Pdyn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PDYN mRNA CTD PMID:22206623 Pdyn Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of PDYN mRNA CTD PMID:21983209 Pdyn Rat 17beta-estradiol multiple interactions EXP 6480464 Tamoxifen inhibits the reaction [Estradiol results in decreased expression of PDYN mRNA] CTD PMID:7895668 Pdyn Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PDYN mRNA CTD PMID:7895668 Pdyn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pdyn (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PDYN mRNA CTD PMID:21570461 Pdyn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pdyn (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PDYN mRNA CTD PMID:33956508 Pdyn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PDYN mRNA CTD PMID:32109520 Pdyn Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Pdyn Rat 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine decreases expression EXP 6480464 4-iodo-2 and 5-dimethoxyphenylisopropylamine results in decreased expression of PDYN mRNA CTD PMID:9526047 Pdyn Rat 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of PDYN mRNA CTD PMID:24008352 Pdyn Rat 2-methyl-6-(phenylethynyl)pyridine multiple interactions EXP 6480464 6-methyl-2-(phenylethynyl)pyridine inhibits the reaction [[Oxidopamine co-treated with Levodopa] results in increased expression of PDYN mRNA] CTD PMID:19660528 Pdyn Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PDYN mRNA CTD PMID:15661373 Pdyn Rat 4,4'-sulfonyldiphenol increases expression ISO Pdyn (Mus musculus) 6480464 bisphenol S results in increased expression of PDYN mRNA CTD PMID:30951980 Pdyn Rat 4-hydroxynon-2-enal decreases expression ISO PDYN (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of PDYN mRNA CTD PMID:12419474 Pdyn Rat 5-aza-2'-deoxycytidine affects expression ISO PDYN (Homo sapiens) 6480464 Decitabine affects the expression of PDYN mRNA CTD PMID:23300844 Pdyn Rat 8-OH-DPAT multiple interactions EXP 6480464 8-Hydroxy-2-(di-n-propylamino)tetralin inhibits the reaction [Levodopa results in increased expression of PDYN mRNA] CTD PMID:19115412 Pdyn Rat aflatoxin B1 decreases methylation ISO PDYN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PDYN gene CTD PMID:27153756 Pdyn Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of PDYN mRNA CTD PMID:20488242 Pdyn Rat all-trans-retinoic acid multiple interactions ISO Pdyn (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PDYN mRNA CTD PMID:36189433 Pdyn Rat all-trans-retinoic acid decreases expression ISO Pdyn (Mus musculus) 6480464 Tretinoin results in decreased expression of PDYN mRNA CTD PMID:36189433 Pdyn Rat alpha-Neoendorphin multiple interactions EXP 6480464 [Glyphosate affects the expression of PDYN protein] which results in decreased abundance of alpha-neoendorphin and [Glyphosate affects the expression of PDYN protein] which results in decreased abundance of alpha-neoendorphin metabolite CTD PMID:34474092 Pdyn Rat amiodarone increases expression ISO PDYN (Homo sapiens) 6480464 Amiodarone results in increased expression of PDYN mRNA CTD PMID:19774075 Pdyn Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PDYN mRNA CTD PMID:16483693 Pdyn Rat amphetamine multiple interactions EXP 6480464 Baclofen inhibits the reaction [Amphetamine results in increased expression of PDYN mRNA] more ... CTD PMID:14521997 more ... Pdyn Rat amphetamine multiple interactions ISO Pdyn (Mus musculus) 6480464 ADORA2A protein affects the reaction [Amphetamine results in increased expression of PDYN mRNA] CTD PMID:12700712 Pdyn Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PDYN mRNA CTD PMID:14521997 more ... Pdyn Rat amphetamine increases expression ISO Pdyn (Mus musculus) 6480464 Amphetamine results in increased expression of PDYN mRNA CTD PMID:12700712 Pdyn Rat Azoxymethane multiple interactions ISO Pdyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDYN mRNA CTD PMID:29950665 Pdyn Rat baclofen multiple interactions EXP 6480464 Baclofen inhibits the reaction [Amphetamine results in increased expression of PDYN mRNA] CTD PMID:15033416 and PMID:15592348 Pdyn Rat benzo[a]pyrene increases expression ISO PDYN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PDYN mRNA CTD PMID:22316170 Pdyn Rat benzo[a]pyrene affects methylation ISO PDYN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PDYN 5' UTR and Benzo(a)pyrene affects the methylation of PDYN promoter CTD PMID:27901495 Pdyn Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDYN mRNA CTD PMID:25181051 more ... Pdyn Rat bisphenol A decreases expression ISO Pdyn (Mus musculus) 6480464 bisphenol A results in decreased expression of PDYN mRNA CTD PMID:34585602 Pdyn Rat bisphenol A decreases methylation ISO Pdyn (Mus musculus) 6480464 bisphenol A results in decreased methylation of PDYN promoter CTD PMID:27312807 Pdyn Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of PDYN mRNA and Capsaicin results in increased expression of PDYN protein CTD PMID:15385614 Pdyn Rat capsaicin multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Capsaicin results in increased expression of PDYN protein] CTD PMID:15385614 Pdyn Rat carbon nanotube increases expression ISO Pdyn (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pdyn Rat CGP 52608 multiple interactions ISO PDYN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PDYN gene] CTD PMID:28238834 Pdyn Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PDYN mRNA CTD PMID:20682304 Pdyn Rat chlorpyrifos decreases expression ISO Pdyn (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PDYN mRNA CTD PMID:32715474 Pdyn Rat cisplatin affects expression ISO PDYN (Homo sapiens) 6480464 Cisplatin affects the expression of PDYN mRNA CTD PMID:23300844 Pdyn Rat Clasto-Lactacystin beta-lactone decreases secretion ISO Pdyn (Mus musculus) 6480464 clasto-lactacystin beta-lactone results in decreased secretion of PDYN protein alternative form CTD PMID:17670969 Pdyn Rat cocaine increases expression ISO PDYN (Homo sapiens) 6480464 Cocaine results in increased expression of PDYN mRNA and Cocaine results in increased expression of PDYN protein CTD PMID:15009677 more ... Pdyn Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PDYN mRNA CTD PMID:10971637 more ... Pdyn Rat cocaine increases expression ISO Pdyn (Mus musculus) 6480464 Cocaine deficiency results in increased expression of PDYN mRNA more ... CTD PMID:10943692 more ... Pdyn Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PDYN mRNA and Cocaine affects the expression of PDYN protein CTD PMID:12128156 more ... Pdyn Rat cocaine increases response to substance ISO Pdyn (Mus musculus) 6480464 PDYN gene mutant form results in increased susceptibility to Cocaine CTD PMID:17532787 Pdyn Rat cocaine multiple interactions ISO Pdyn (Mus musculus) 6480464 [[Cocaine results in increased phosphorylation of and results in increased activity of MAPK1 protein] which results in increased expression of FOS protein] which affects the expression of PDYN protein more ... CTD PMID:10943692 more ... Pdyn Rat cocaine increases response to substance ISO PDYN (Homo sapiens) 6480464 PDYN promoter polymorphism results in increased susceptibility to Cocaine CTD PMID:16184603 Pdyn Rat cocaine affects response to substance ISO PDYN (Homo sapiens) 6480464 PDYN gene SNP affects the susceptibility to Cocaine CTD PMID:18923396 Pdyn Rat cocaine decreases response to substance ISO PDYN (Homo sapiens) 6480464 PDYN promoter polymorphism results in decreased susceptibility to Cocaine CTD PMID:11992566 Pdyn Rat corticosterone multiple interactions EXP 6480464 Corticosterone inhibits the reaction [[Oxidopamine co-treated with Levodopa] results in increased expression of PDYN mRNA] CTD PMID:18687386 Pdyn Rat corticosterone multiple interactions ISO Pdyn (Mus musculus) 6480464 PDYN protein promotes the reaction [Cocaine results in increased abundance of Corticosterone] CTD PMID:17532787 Pdyn Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of PDYN mRNA CTD PMID:23914054 Pdyn Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PDYN mRNA CTD PMID:23914054 Pdyn Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of PDYN mRNA CTD PMID:14618091 Pdyn Rat dextran sulfate multiple interactions ISO Pdyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDYN mRNA CTD PMID:29950665 Pdyn Rat diazepam multiple interactions EXP 6480464 Diazepam inhibits the reaction [Kainic Acid results in increased expression of PDYN mRNA] CTD PMID:8417141 Pdyn Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PDYN mRNA CTD PMID:21266533 Pdyn Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PDYN mRNA CTD PMID:21266533 Pdyn Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of PDYN mRNA CTD PMID:37077353 Pdyn Rat dorsomorphin multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pdyn Rat doxorubicin decreases expression ISO PDYN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PDYN mRNA CTD PMID:29803840 Pdyn Rat Dynorphin B multiple interactions EXP 6480464 [Glyphosate affects the expression of PDYN protein] which results in decreased abundance of rimorphin CTD PMID:34474092 Pdyn Rat entinostat increases expression ISO PDYN (Homo sapiens) 6480464 entinostat results in increased expression of PDYN mRNA CTD PMID:26272509 and PMID:27188386 Pdyn Rat entinostat multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDYN mRNA CTD PMID:27188386 Pdyn Rat epoxomicin decreases expression EXP 6480464 epoxomicin results in decreased expression of PDYN protein alternative form CTD PMID:17670969 Pdyn Rat epoxomicin multiple interactions ISO Pdyn (Mus musculus) 6480464 epoxomicin inhibits the reaction [Potassium results in increased secretion of PDYN protein alternative form] and epoxomicin results in decreased expression of and results in decreased secretion of PDYN protein alternative form CTD PMID:17670969 Pdyn Rat ethanol multiple interactions ISO PDYN (Homo sapiens) 6480464 fomepizole inhibits the reaction [Ethanol results in decreased expression of PDYN mRNA] CTD PMID:17934066 Pdyn Rat ethanol affects expression ISO Pdyn (Mus musculus) 6480464 Ethanol affects the expression of PDYN mRNA CTD PMID:30319688 Pdyn Rat ethanol affects response to substance ISO PDYN (Homo sapiens) 6480464 PDYN gene SNP affects the susceptibility to Ethanol CTD PMID:18923396 Pdyn Rat ethanol decreases expression ISO PDYN (Homo sapiens) 6480464 Ethanol results in decreased expression of PDYN mRNA CTD PMID:17934066 Pdyn Rat fentanyl increases expression EXP 6480464 Fentanyl results in increased expression of PDYN protein CTD PMID:19200067 Pdyn Rat fluoxetine affects expression EXP 6480464 Fluoxetine affects the expression of PDYN protein CTD PMID:14997015 Pdyn Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of PDYN mRNA CTD PMID:15936043 Pdyn Rat folic acid multiple interactions ISO Pdyn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PDYN mRNA CTD PMID:22206623 Pdyn Rat fomepizole multiple interactions ISO PDYN (Homo sapiens) 6480464 fomepizole inhibits the reaction [Ethanol results in decreased expression of PDYN mRNA] CTD PMID:17934066 Pdyn Rat ginsenoside Re multiple interactions ISO Pdyn (Mus musculus) 6480464 3-((3 more ... CTD PMID:29467000 Pdyn Rat glyphosate multiple interactions EXP 6480464 [Glyphosate affects the expression of PDYN protein] which results in decreased abundance of alpha-neoendorphin more ... CTD PMID:34474092 Pdyn Rat glyphosate affects expression EXP 6480464 Glyphosate affects the expression of PDYN protein CTD PMID:34474092 Pdyn Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of PDYN protein CTD PMID:34474092 Pdyn Rat haloperidol multiple interactions EXP 6480464 [1-aminocyclopentane-1 more ... CTD PMID:17224239 Pdyn Rat heroin decreases expression ISO PDYN (Homo sapiens) 6480464 Heroin results in decreased expression of PDYN mRNA CTD PMID:16710320 Pdyn Rat heroin increases expression EXP 6480464 Heroin results in increased expression of PDYN mRNA CTD PMID:19100723 Pdyn Rat hydrogen peroxide decreases expression ISO PDYN (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of PDYN mRNA CTD PMID:12419474 Pdyn Rat kainic acid multiple interactions EXP 6480464 Diazepam inhibits the reaction [Kainic Acid results in increased expression of PDYN mRNA] more ... CTD PMID:1465197 and PMID:8417141 Pdyn Rat kainic acid affects expression EXP 6480464 Kainic Acid affects the expression of PDYN mRNA CTD PMID:1465197 Pdyn Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of PDYN mRNA CTD PMID:8417141 Pdyn Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of PDYN mRNA CTD PMID:37077353 Pdyn Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PDYN mRNA CTD PMID:11578147 Pdyn Rat lipopolysaccharide increases expression ISO Pdyn (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PDYN mRNA CTD PMID:12057914 Pdyn Rat maneb multiple interactions EXP 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PDYN CTD PMID:24376148 Pdyn Rat methamphetamine increases response to substance ISO PDYN (Homo sapiens) 6480464 PDYN promoter polymorphism results in increased susceptibility to Methamphetamine CTD PMID:16529859 Pdyn Rat methamphetamine decreases expression ISO Pdyn (Mus musculus) 6480464 Methamphetamine results in decreased expression of PDYN mRNA and Methamphetamine results in decreased expression of PDYN protein CTD PMID:29467000 Pdyn Rat methamphetamine increases response to substance ISO Pdyn (Mus musculus) 6480464 PDYN gene mutant form results in increased susceptibility to Methamphetamine CTD PMID:29467000 Pdyn Rat methamphetamine multiple interactions ISO Pdyn (Mus musculus) 6480464 3-((3 more ... CTD PMID:29467000 Pdyn Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PDYN mRNA CTD PMID:20298714 Pdyn Rat methamphetamine multiple interactions EXP 6480464 CTAP octapeptide inhibits the reaction [Methamphetamine results in increased expression of PDYN mRNA] CTD PMID:20298714 Pdyn Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of PDYN gene CTD PMID:23303685 Pdyn Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PDYN gene CTD PMID:35440735 Pdyn Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PDYN mRNA CTD PMID:38113427 Pdyn Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Pdyn (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PDYN mRNA CTD PMID:36189433 Pdyn Rat morphine increases expression ISO Pdyn (Mus musculus) 6480464 Morphine results in increased expression of PDYN protein alternative form CTD PMID:20359526 Pdyn Rat morphine decreases expression ISO Pdyn (Mus musculus) 6480464 Morphine deficiency results in decreased expression of PDYN mRNA CTD PMID:27126842 Pdyn Rat morphine decreases expression EXP 6480464 Morphine results in decreased expression of PDYN mRNA CTD PMID:17401159 Pdyn Rat morphine multiple interactions ISO Pdyn (Mus musculus) 6480464 [Zymosan co-treated with Morphine] results in increased expression of PDYN mRNA and GRIK1 protein affects the reaction [Morphine results in increased expression of PDYN protein alternative form] CTD PMID:15979727 and PMID:20359526 Pdyn Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases secretion ISO Pdyn (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased secretion of PDYN protein alternative form CTD PMID:17670969 Pdyn Rat Nandrolone decanoate increases expression EXP 6480464 nandrolone decanoate results in increased expression of PDYN mRNA CTD PMID:19782718 Pdyn Rat Norbinaltorphimine multiple interactions ISO Pdyn (Mus musculus) 6480464 3-((3 more ... CTD PMID:29467000 Pdyn Rat oxidopamine multiple interactions ISO Pdyn (Mus musculus) 6480464 [Levodopa co-treated with Oxidopamine] results in increased expression of PDYN mRNA more ... CTD PMID:15207268 more ... Pdyn Rat oxidopamine decreases expression EXP 6480464 Oxidopamine results in decreased expression of PDYN mRNA CTD PMID:15659429 more ... Pdyn Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of PDYN mRNA CTD PMID:12127155 more ... Pdyn Rat oxidopamine decreases expression ISO Pdyn (Mus musculus) 6480464 Oxidopamine results in decreased expression of PDYN mRNA CTD PMID:16139809 Pdyn Rat oxidopamine multiple interactions EXP 6480464 6-methyl-2-(phenylethynyl)pyridine inhibits the reaction [[Oxidopamine co-treated with Levodopa] results in increased expression of PDYN mRNA] more ... CTD PMID:15659429 more ... Pdyn Rat Oxymorphone increases expression EXP 6480464 Oxymorphone results in increased expression of PDYN protein alternative form CTD PMID:16343768 Pdyn Rat ozone increases expression ISO Pdyn (Mus musculus) 6480464 Ozone results in increased expression of PDYN mRNA CTD PMID:31626304 Pdyn Rat panobinostat multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDYN mRNA CTD PMID:27188386 Pdyn Rat panobinostat increases expression ISO PDYN (Homo sapiens) 6480464 panobinostat results in increased expression of PDYN mRNA CTD PMID:26272509 Pdyn Rat paracetamol decreases expression ISO PDYN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PDYN mRNA CTD PMID:26690555 Pdyn Rat paraquat multiple interactions EXP 6480464 [Paraquat co-treated with Maneb] results in decreased expression of PDYN CTD PMID:24376148 Pdyn Rat pentetrazol decreases expression EXP 6480464 Pentylenetetrazole results in decreased expression of PDYN mRNA CTD PMID:1465197 Pdyn Rat pentetrazol increases cleavage EXP 6480464 Pentylenetetrazole results in increased cleavage of PDYN protein CTD PMID:1465197 Pdyn Rat pentobarbital multiple interactions EXP 6480464 Pentobarbital inhibits the reaction [Kainic Acid results in increased expression of PDYN mRNA] CTD PMID:8417141 Pdyn Rat pirinixic acid increases expression ISO Pdyn (Mus musculus) 6480464 pirinixic acid results in increased expression of PDYN mRNA CTD PMID:20813756 Pdyn Rat potassium atom multiple interactions ISO Pdyn (Mus musculus) 6480464 epoxomicin inhibits the reaction [Potassium results in increased secretion of PDYN protein alternative form] CTD PMID:17670969 Pdyn Rat potassium atom increases secretion ISO Pdyn (Mus musculus) 6480464 Potassium results in increased secretion of PDYN protein alternative form CTD PMID:17670969 Pdyn Rat prochloraz increases expression EXP 6480464 prochloraz results in increased expression of PDYN mRNA CTD PMID:29038839 Pdyn Rat rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of PDYN mRNA CTD PMID:24008352 Pdyn Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of PDYN mRNA CTD PMID:16079270 Pdyn Rat resveratrol multiple interactions ISO PDYN (Homo sapiens) 6480464 Resveratrol inhibits the reaction [[SOD1 protein mutant form results in increased susceptibility to Thimerosal] which results in increased expression of PDYN mRNA] CTD PMID:30503815 Pdyn Rat ritanserin increases expression EXP 6480464 Ritanserin results in increased expression of PDYN mRNA CTD PMID:9526047 Pdyn Rat SB 431542 multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pdyn Rat scopolamine decreases response to substance ISO Pdyn (Mus musculus) 6480464 PDYN protein modified form results in decreased susceptibility to Scopolamine CTD PMID:7768285 Pdyn Rat scopolamine multiple interactions ISO Pdyn (Mus musculus) 6480464 MR 2266 inhibits the reaction [PDYN protein modified form results in decreased susceptibility to Scopolamine] CTD PMID:7768285 Pdyn Rat scopolamine increases expression EXP 6480464 Scopolamine results in increased expression of PDYN mRNA CTD PMID:17540011 Pdyn Rat SL-327 multiple interactions EXP 6480464 SL 327 inhibits the reaction [Dextroamphetamine results in increased expression of PDYN mRNA] CTD PMID:16459022 Pdyn Rat sodium arsenite affects methylation ISO PDYN (Homo sapiens) 6480464 sodium arsenite affects the methylation of PDYN gene CTD PMID:28589171 Pdyn Rat tamoxifen multiple interactions EXP 6480464 Tamoxifen inhibits the reaction [Estradiol results in decreased expression of PDYN mRNA] CTD PMID:7895668 Pdyn Rat tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of PDYN mRNA and Tamoxifen results in increased expression of PDYN protein alternative form CTD PMID:7895668 Pdyn Rat thimerosal multiple interactions ISO PDYN (Homo sapiens) 6480464 [SOD1 protein mutant form results in increased susceptibility to Thimerosal] which results in increased expression of PDYN mRNA and Resveratrol inhibits the reaction [[SOD1 protein mutant form results in increased susceptibility to Thimerosal] which results in increased expression of PDYN mRNA] CTD PMID:30503815 Pdyn Rat titanium dioxide increases expression ISO Pdyn (Mus musculus) 6480464 titanium dioxide results in increased expression of PDYN mRNA CTD PMID:23557971 Pdyn Rat titanium dioxide decreases methylation ISO Pdyn (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PDYN gene CTD PMID:35295148 Pdyn Rat titanium dioxide multiple interactions ISO Pdyn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDYN mRNA CTD PMID:29950665 Pdyn Rat tramadol decreases expression EXP 6480464 Tramadol results in decreased expression of PDYN mRNA CTD PMID:17401159 Pdyn Rat trichostatin A increases expression ISO Pdyn (Mus musculus) 6480464 trichostatin A results in increased expression of PDYN mRNA CTD PMID:24204683 Pdyn Rat trichostatin A multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDYN mRNA CTD PMID:27188386 Pdyn Rat trichostatin A increases expression ISO PDYN (Homo sapiens) 6480464 trichostatin A results in increased expression of PDYN mRNA CTD PMID:24935251 and PMID:26272509 Pdyn Rat triphenyl phosphate multiple interactions ISO Pdyn (Mus musculus) 6480464 [tris(1 and 3-dichloro-2-propyl)phosphate co-treated with Tritolyl Phosphates co-treated with triphenyl phosphate] results in increased expression of PDYN mRNA CTD PMID:32360330 Pdyn Rat U69593 multiple interactions EXP 6480464 U 69593 inhibits the reaction [Dextroamphetamine results in increased expression of PDYN mRNA] CTD PMID:11532335 Pdyn Rat valproic acid affects expression ISO Pdyn (Mus musculus) 6480464 Valproic Acid affects the expression of PDYN mRNA CTD PMID:17963808 Pdyn Rat valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Kainic Acid results in increased expression of PDYN mRNA] CTD PMID:8417141 Pdyn Rat valproic acid affects expression ISO PDYN (Homo sapiens) 6480464 Valproic Acid affects the expression of PDYN mRNA CTD PMID:25979313 Pdyn Rat valproic acid increases expression ISO PDYN (Homo sapiens) 6480464 Valproic Acid results in increased expression of PDYN mRNA CTD PMID:23179753 more ... Pdyn Rat valproic acid multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDYN mRNA CTD PMID:27188386 Pdyn Rat vanoxerine dihydrochloride affects expression EXP 6480464 vanoxerine affects the expression of PDYN protein CTD PMID:14997015 Pdyn Rat vorinostat multiple interactions ISO PDYN (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PDYN mRNA CTD PMID:27188386 Pdyn Rat vorinostat increases expression ISO PDYN (Homo sapiens) 6480464 vorinostat results in increased expression of PDYN mRNA CTD PMID:26272509
(R,R)-tramadol (EXP) (S)-amphetamine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine (EXP) 2-hydroxypropanoic acid (EXP) 2-methyl-6-(phenylethynyl)pyridine (EXP) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 8-OH-DPAT (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-Neoendorphin (EXP) amiodarone (ISO) ammonium chloride (EXP) amphetamine (EXP,ISO) Azoxymethane (ISO) baclofen (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) capsaicin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) Clasto-Lactacystin beta-lactone (ISO) cocaine (EXP,ISO) corticosterone (EXP,ISO) decabromodiphenyl ether (EXP) dexamethasone (EXP) dextran sulfate (ISO) diazepam (EXP) dibutyl phthalate (EXP) diethylstilbestrol (EXP) dorsomorphin (ISO) doxorubicin (ISO) Dynorphin B (EXP) entinostat (ISO) epoxomicin (EXP,ISO) ethanol (ISO) fentanyl (EXP) fluoxetine (EXP) folic acid (ISO) fomepizole (ISO) ginsenoside Re (ISO) glyphosate (EXP) haloperidol (EXP) heroin (EXP,ISO) hydrogen peroxide (ISO) kainic acid (EXP) ketoconazole (EXP) lead diacetate (EXP) lipopolysaccharide (ISO) maneb (EXP) methamphetamine (EXP,ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (EXP,ISO) morphine (EXP,ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) Nandrolone decanoate (EXP) Norbinaltorphimine (ISO) oxidopamine (EXP,ISO) Oxymorphone (EXP) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) pentetrazol (EXP) pentobarbital (EXP) pirinixic acid (ISO) potassium atom (ISO) prochloraz (EXP) rac-lactic acid (EXP) raloxifene (EXP) resveratrol (ISO) ritanserin (EXP) SB 431542 (ISO) scopolamine (EXP,ISO) SL-327 (EXP) sodium arsenite (ISO) tamoxifen (EXP) thimerosal (ISO) titanium dioxide (ISO) tramadol (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) U69593 (EXP) valproic acid (EXP,ISO) vanoxerine dihydrochloride (EXP) vorinostat (ISO)
1.
Impaired periamygdaloid-cortex prodynorphin is characteristic of opiate addiction and depression.
Anderson SA, etal., J Clin Invest. 2013 Dec;123(12):5334-41. doi: 10.1172/JCI70395. Epub 2013 Nov 15.
2.
The endogenous opioid system in human alcoholics: molecular adaptations in brain areas involved in cognitive control of addiction.
Bazov I, etal., Addict Biol. 2013 Jan;18(1):161-9. doi: 10.1111/j.1369-1600.2011.00366.x. Epub 2011 Sep 28.
3.
Downregulation of the neuronal opioid gene expression concomitantly with neuronal decline in dorsolateral prefrontal cortex of human alcoholics.
Bazov I, etal., Transl Psychiatry. 2018 Jun 20;8(1):122. doi: 10.1038/s41398-017-0075-5.
4.
Alteration of kappa-opioid receptor system expression in distinct brain regions of a genetic model of enhanced ethanol withdrawal severity.
Beadles-Bohling AS and Wiren KM, Brain Res. 2005 Jun 7;1046(1-2):77-89. doi: 10.1016/j.brainres.2005.03.043.
5.
Short-term withdrawal from repeated exposure to cocaine during adolescence modulates dynorphin mRNA levels and BDNF signaling in the rat nucleus accumbens.
Caputi FF, etal., Drug Alcohol Depend. 2019 Apr 1;197:127-133. doi: 10.1016/j.drugalcdep.2019.01.006. Epub 2019 Feb 13.
6.
Opioid gene expression changes and post-translational histone modifications at promoter regions in the rat nucleus accumbens after acute and repeated 3,4-methylenedioxy-methamphetamine (MDMA) exposure.
Caputi FF, etal., Pharmacol Res. 2016 Dec;114:209-218. doi: 10.1016/j.phrs.2016.10.023. Epub 2016 Oct 29.
7.
Potentially functional polymorphism in the promoter region of prodynorphin gene may be associated with protection against cocaine dependence or abuse.
Chen AC, etal., Am J Med Genet. 2002 May 8;114(4):429-35. doi: 10.1002/ajmg.10362.
8.
Changes of mRNA expression of enkephalin and prodynorphin in hippocampus of rats with chronic immobilization stress.
Chen JX, etal., World J Gastroenterol. 2004 Sep 1;10(17):2547-9. doi: 10.3748/wjg.v10.i17.2547.
9.
Effect of adenoviral delivery of prodynorphin gene on experimental inflammatory pain induced by formalin in rats.
Chen X, etal., Int J Clin Exp Med. 2014 Dec 15;7(12):4877-86. eCollection 2014.
10.
Sequence and expression of the rat prodynorphin gene.
Civelli O, etal., Proc Natl Acad Sci U S A 1985 Jun;82(12):4291-5.
11.
An association of prodynorphin polymorphisms and opioid dependence in females in a Chinese population.
Clarke TK, etal., Addict Biol. 2009 Jul;14(3):366-70. doi: 10.1111/j.1369-1600.2009.00151.x. Epub 2009 Mar 5.
12.
Genetic association analyses of PDYN polymorphisms with heroin and cocaine addiction.
Clarke TK, etal., Genes Brain Behav. 2012 Jun;11(4):415-23. doi: 10.1111/j.1601-183X.2012.00785.x. Epub 2012 Apr 11.
13.
Virus-mediated shRNA knockdown of prodynorphin in the rat nucleus accumbens attenuates depression-like behavior and cocaine locomotor sensitization.
Cohen A, etal., PLoS One. 2014 May 9;9(5):e97216. doi: 10.1371/journal.pone.0097216. eCollection 2014.
14.
Opioid system genes in alcoholism: a case-control study in Croatian population.
Cupic B, etal., Neuropeptides. 2013 Oct;47(5):315-9. doi: 10.1016/j.npep.2013.08.002. Epub 2013 Aug 28.
15.
Genetic variation and epigenetic modification of the prodynorphin gene in peripheral blood cells in alcoholism.
D'Addario C, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2017 Jun 2;76:195-203. doi: 10.1016/j.pnpbp.2017.03.012. Epub 2017 Mar 21.
16.
Confirmation of the association between a polymorphism in the promoter region of the prodynorphin gene and cocaine dependence.
Dahl JP, etal., Am J Med Genet B Neuropsychiatr Genet. 2005 Nov 5;139B(1):106-8. doi: 10.1002/ajmg.b.30238.
17.
Chronic and acute effects of 3,4-methylenedioxy-N-methylamphetamine ('Ecstasy') administration on the dynorphinergic system in the rat brain.
Di Benedetto M, etal., Neuroscience. 2006;137(1):187-96. doi: 10.1016/j.neuroscience.2005.09.015. Epub 2005 Nov 10.
18.
Characterization of the rat prodynorphin gene.
Douglass J, etal., Mol Endocrinol 1989 Dec;3(12):2070-8.
19.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
20.
Changes in the prodynorphin gene and DARPP-32 state in 6-OHDA-lesioned rats following long-term treatment with l-dopa.
Guan Q, etal., Neurosci Lett. 2007 Oct 9;426(1):64-8. doi: 10.1016/j.neulet.2007.08.043. Epub 2007 Aug 25.
21.
L-DOPA-induced dyskinesia is associated with regional increase of striatal dynorphin peptides as elucidated by imaging mass spectrometry.
Hanrieder J, etal., Mol Cell Proteomics. 2011 Oct;10(10):M111.009308. doi: 10.1074/mcp.M111.009308. Epub 2011 Jul 6.
22.
Evaluation of prodynorphin gene polymorphisms and their association with heroin addiction in a sample of the southeast Iranian population.
Hashemi M, etal., Mol Biol Res Commun. 2018 Mar;7(1):1-6. doi: 10.22099/mbrc.2017.27182.1294.
23.
Colocalization of CART peptide with prodynorphin and dopamine D1 receptors in the rat nucleus accumbens.
Hubert GW and Kuhar MJ, Neuropeptides. 2006 Dec;40(6):409-15. Epub 2006 Oct 24.
24.
Prodynorphin mRNA expression in the rat dentate gyrus after cerebral ischemia.
Héron A, etal., Neuropeptides. 1996 Aug;30(4):355-8. doi: 10.1016/s0143-4179(96)90024-4.
25.
Dynorphin A, kappa opioid receptors and the antinociceptive efficacy of asimadoline in streptozotocin-induced diabetic rats.
Jolivalt CG, etal., Diabetologia. 2006 Nov;49(11):2775-85. Epub 2006 Aug 19.
26.
Association of the PDYN gene with alcohol dependence and the propensity to drink in negative emotional states.
Karpyak VM, etal., Int J Neuropsychopharmacol. 2013 Jun;16(5):975-85. doi: 10.1017/S1461145712001137. Epub 2012 Oct 29.
27.
Association of PDYN 68-bp VNTR polymorphism with sublingual buprenorphine/naloxone treatment and with opioid or alcohol use disorder: Effect on craving, depression, anxiety and age onset of first use.
Kaya-Akyüzlü D, etal., Eur J Pharmacol. 2022 Apr 15;921:174862. doi: 10.1016/j.ejphar.2022.174862. Epub 2022 Mar 7.
28.
Corelease of dynorphin-like immunoreactivity, luteinizing hormone, and follicle-stimulating hormone from rat adenohypophysis in vitro.
Knepel W, etal., Endocrinology. 1985 Aug;117(2):481-7. doi: 10.1210/endo-117-2-481.
29.
Proenkephalin and prodynorphin mRNA level in brain of rats with absence epilepsy.
Lasoń W, etal., Neuropeptides. 1994 Dec;27(6):343-7. doi: 10.1016/0143-4179(94)90060-4.
30.
Embryonic ventral mesencephalic grafts improve levodopa-induced dyskinesia in a rat model of Parkinson's disease.
Lee CS, etal., Brain. 2000 Jul;123 ( Pt 7):1365-79. doi: 10.1093/brain/123.7.1365.
31.
Association of Alcohol Use Disorder Risk With ADH1B, DRD2, FAAH, SLC39A8, GCKR, and PDYN Genetic Polymorphisms.
Legaki E, etal., In Vivo. 2022 Sep-Oct;36(5):2092-2104. doi: 10.21873/invivo.12935.
32.
From unilateral to bilateral parkinsonism: Effects of lateralization on dyskinesias and associated molecular mechanisms.
Marin C, etal., Neuropharmacology. 2015 Oct;97:365-75. doi: 10.1016/j.neuropharm.2015.06.004. Epub 2015 Jun 22.
33.
Regulation of gene expression by chronic morphine and morphine withdrawal in the locus ceruleus and ventral tegmental area.
McClung CA, etal., J Neurosci. 2005 Jun 22;25(25):6005-15. doi: 10.1523/JNEUROSCI.0062-05.2005.
34.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
35.
An analysis of genetic association in opioid dependence susceptibility.
Nagaya D, etal., J Clin Pharm Ther. 2018 Feb;43(1):80-86. doi: 10.1111/jcpt.12585. Epub 2017 Jun 27.
36.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
37.
Genetic variant of prodynorphin gene is risk factor for methamphetamine dependence.
Nomura A, etal., Neurosci Lett. 2006 May 29;400(1-2):158-62. doi: 10.1016/j.neulet.2006.02.038. Epub 2006 Mar 9.
38.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
39.
Common transcriptional effects in the mouse striatum following chronic treatment with heroin and methamphetamine.
Piechota M, etal., Genes Brain Behav. 2012 Jun;11(4):404-14. doi: 10.1111/j.1601-183X.2012.00777.x. Epub 2012 Apr 11.
40.
PDYN rs2281285 variant association with drinking to avoid emotional or somatic discomfort.
Preuss UW, etal., PLoS One. 2013 Nov 6;8(11):e78688. doi: 10.1371/journal.pone.0078688. eCollection 2013.
41.
Repeated ethanol administration decreases prodynorphin biosynthesis in the rat hippocampus.
Przewłocka B, etal., Neurosci Lett. 1992 Jan 6;134(2):195-8. doi: 10.1016/0304-3940(92)90515-9.
42.
The effect of single and repeated morphine administration on the prodynorphin system activity in the nucleus accumbens and striatum of the rat.
Przewłocka B, etal., Neuroscience. 1996 Feb;70(3):749-54. doi: 10.1016/s0306-4522(96)83012-0.
43.
Expression of the prodynorphin gene after experimental brain injury and its role in behavioral dysfunction.
Redell JB, etal., Exp Biol Med (Maywood) 2003 Mar;228(3):261-9.
44.
GOA pipeline
RGD automated data pipeline
45.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
46.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
47.
Chronic intracerebroventricular cocaine differentially affects prodynorphin gene expression in rat hypothalamus and caudate-putamen.
Romualdi P, etal., Brain Res Mol Brain Res. 1996 Aug;40(1):153-6. doi: 10.1016/0169-328x(96)00091-5.
48.
Early changes in prodynorphin mRNA and ir-dynorphin A levels after kindled seizures in the rat.
Romualdi P, etal., Eur J Neurosci. 1995 Sep 1;7(9):1850-6. doi: 10.1111/j.1460-9568.1995.tb00705.x.
49.
Region-specific changes in prodynorphin mRNA and ir-dynorphin A levels after kindled seizures.
Romualdi P, etal., J Mol Neurosci. 1999 Aug-Oct;13(1-2):69-75. doi: 10.1385/JMN:13:1-2:69.
50.
Long-term antagonism of κ opioid receptors prevents escalation of and increased motivation for heroin intake.
Schlosburg JE, etal., J Neurosci. 2013 Dec 4;33(49):19384-92. doi: 10.1523/JNEUROSCI.1979-13.2013.
51.
Evaluation of dynorphin and kappa-opioid receptor level in the human blood lymphocytes and plasma: Possible role as a biomarker in severe opioid use disorder.
Shahkarami K, etal., Drug Alcohol Depend. 2019 Dec 1;205:107638. doi: 10.1016/j.drugalcdep.2019.107638. Epub 2019 Nov 2.
52.
'Binge' cocaine administration induces a sustained increase of prodynorphin mRNA in rat caudate-putamen.
Spangler R, etal., Brain Res Mol Brain Res. 1993 Sep;19(4):323-7. doi: 10.1016/0169-328x(93)90133-a.
53.
A functional polymorphism in the prodynorphin gene promotor is associated with temporal lobe epilepsy.
Stogmann E, etal., Ann Neurol 2002 Feb;51(2):260-3.
54.
Prodynorphin CpG-SNPs associated with alcohol dependence: elevated methylation in the brain of human alcoholics.
Taqi MM, etal., Addict Biol. 2011 Jul;16(3):499-509. doi: 10.1111/j.1369-1600.2011.00323.x. Epub 2011 Apr 26.
55.
Upregulation of the kappa opioidergic system in left ventricular rat myocardium in response to volume overload: Adaptive changes of the cardiac kappa opioid system in heart failure.
Treskatsch S, etal., Pharmacol Res. 2015 Dec;102:33-41. doi: 10.1016/j.phrs.2015.09.005. Epub 2015 Sep 10.
56.
Effect of cocaine and amphetamine on biosynthesis of proenkephalin and prodynorphin in some regions of the rat limbic system.
Turchan J, etal., Pol J Pharmacol. 2002 Jul-Aug;54(4):367-72.
57.
Chronic nicotine-induced changes in gene expression of delta and kappa-opioid receptors and their endogenous ligands in the mesocorticolimbic system of the rat.
Ugur M, etal., Synapse. 2017 Sep;71(9). doi: 10.1002/syn.21985. Epub 2017 May 29.
58.
Dynorphin-immunoreactive terminals in the rat nucleus accumbens: cellular sites for modulation of target neurons and interactions with catecholamine afferents.
Van Bockstaele EJ, etal., J Comp Neurol. 1994 Mar 1;341(1):1-15. doi: 10.1002/cne.903410102.
59.
Association between heroin dependence and prodynorphin gene polymorphisms.
Wei SG, etal., Brain Res Bull. 2011 May 30;85(3-4):238-42. doi: 10.1016/j.brainresbull.2011.02.010. Epub 2011 Mar 4.
60.
Prenatal ethanol induces an anxiety phenotype and alters expression of dynorphin & nociceptin/orphanin FQ genes.
Wille-Bille A, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2018 Jul 13;85:77-88. doi: 10.1016/j.pnpbp.2018.04.005. Epub 2018 Apr 18.
61.
Associations of prodynorphin sequence variation with alcohol dependence and related traits are phenotype-specific and sex-dependent.
Winham SJ, etal., Sci Rep. 2015 Oct 27;5:15670. doi: 10.1038/srep15670.
62.
Association of the kappa-opioid system with alcohol dependence.
Xuei X, etal., Mol Psychiatry. 2006 Nov;11(11):1016-24. doi: 10.1038/sj.mp.4001882. Epub 2006 Aug 22.
63.
Prodynorphin storage and processing in axon terminals and dendrites.
Yakovleva T, etal., FASEB J. 2006 Oct;20(12):2124-6. doi: 10.1096/fj.06-6174fje. Epub 2006 Sep 11.
64.
Genetic association analyses and meta-analysis of Dynorphin-Kappa Opioid system potential functional variants with heroin dependence.
Yuanyuan J, etal., Neurosci Lett. 2018 Oct 15;685:75-82. doi: 10.1016/j.neulet.2018.08.023. Epub 2018 Aug 20.
65.
A functional haplotype implicated in vulnerability to develop cocaine dependence is associated with reduced PDYN expression in human brain.
Yuferov V, etal., Neuropsychopharmacology. 2009 Apr;34(5):1185-97. doi: 10.1038/npp.2008.187. Epub 2008 Oct 15.
66.
Association of variants of prodynorphin promoter 68-bp repeats in caucasians with opioid dependence diagnosis: Effect on age trajectory of heroin use.
Yuferov V, etal., Neurosci Lett. 2019 Jun 21;704:100-105. doi: 10.1016/j.neulet.2019.03.038. Epub 2019 Mar 29.
67.
Further studies on possible dynorphin involvement in the ovulatory luteinizing hormone surge in the proestrous rat.
Zhang Q, etal., Endocrine 2002 Aug;18(3):231-8.
68.
Chronic escalating cocaine exposure, abstinence/withdrawal, and chronic re-exposure: effects on striatal dopamine and opioid systems in C57BL/6J mice.
Zhang Y, etal., Neuropharmacology. 2013 Apr;67:259-66. doi: 10.1016/j.neuropharm.2012.10.015. Epub 2012 Nov 16.
69.
Analgesic effect of different moxibustion durations in rheumatoid arthritis rats.
Zheng B, etal., J Tradit Chin Med. 2014 Feb;34(1):90-5. doi: 10.1016/s0254-6272(14)60060-1.
70.
Effect of PDYN and OPRK1 polymorphisms on the risk of alcohol use disorder and the intensity of depressive symptoms.
Özkan-Kotiloğlu S, etal., Alcohol Alcohol. 2023 Jul 10;58(4):404-414. doi: 10.1093/alcalc/agad036.
Pdyn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 137,354,161 - 137,366,503 (-) NCBI GRCr8 mRatBN7.2 3 116,900,990 - 116,913,334 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 116,900,992 - 116,913,334 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 120,798,229 - 120,810,577 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 129,393,853 - 129,406,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 127,054,324 - 127,066,672 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 122,194,327 - 122,206,671 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 122,194,329 - 122,206,671 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 127,809,688 - 127,822,296 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 117,291,025 - 117,303,367 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 117,196,597 - 117,208,923 (-) NCBI Celera 3 115,716,443 - 115,728,785 (-) NCBI Celera Cytogenetic Map 3 q36 NCBI
PDYN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 1,978,756 - 1,994,285 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 1,978,757 - 1,994,285 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 1,959,402 - 1,974,931 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 1,907,402 - 1,922,702 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 1,907,402 - 1,922,702 NCBI Celera 20 2,023,375 - 2,038,860 (-) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 1,909,347 - 1,924,873 (-) NCBI HuRef CHM1_1 20 1,959,620 - 1,975,149 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 2,008,889 - 2,024,418 (-) NCBI T2T-CHM13v2.0
Pdyn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 129,528,469 - 129,541,858 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 129,528,485 - 129,541,764 (-) Ensembl GRCm39 Ensembl GRCm38 2 129,686,549 - 129,699,938 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 129,686,565 - 129,699,844 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 129,513,737 - 129,515,604 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 129,378,007 - 129,391,274 (-) NCBI MGSCv36 mm8 Celera 2 130,916,433 - 130,918,300 (-) NCBI Celera Cytogenetic Map 2 F1 NCBI cM Map 2 63.19 NCBI
Pdyn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 13,106,062 - 13,119,515 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 13,106,087 - 13,119,497 (-) NCBI ChiLan1.0 ChiLan1.0
PDYN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 2,972,785 - 2,988,767 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 2,969,613 - 2,985,594 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 2,092,171 - 2,108,141 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 1,856,850 - 1,872,452 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 1,856,850 - 1,872,452 (-) Ensembl panpan1.1 panPan2
PDYN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 19,043,955 - 19,057,413 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 19,053,870 - 19,056,364 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 18,871,870 - 18,885,766 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 19,500,321 - 19,514,217 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 19,498,268 - 19,514,210 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 19,056,568 - 19,070,465 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 19,167,367 - 19,181,264 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 19,495,948 - 19,509,844 (+) NCBI UU_Cfam_GSD_1.0
Pdyn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 168,127,664 - 168,140,097 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 16,559,217 - 16,571,678 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 16,559,371 - 16,571,461 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDYN
PDYN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 54,535,516 - 54,551,085 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 54,535,240 - 54,551,104 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666087 951,337 - 967,337 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdyn
.
Predicted Target Of
Count of predictions: 425 Count of miRNA genes: 226 Interacting mature miRNAs: 282 Transcripts: ENSRNOT00000037576 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
27
107
45
38
16
10
16
2
104
52
91
24
59
22
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037576 ⟹ ENSRNOP00000038921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 116,900,992 - 116,913,334 (-) Ensembl Rnor_6.0 Ensembl 3 122,194,329 - 122,206,671 (-) Ensembl
RefSeq Acc Id:
NM_019374 ⟹ NP_062247
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 137,354,161 - 137,366,503 (-) NCBI mRatBN7.2 3 116,900,992 - 116,913,334 (-) NCBI Rnor_6.0 3 122,194,329 - 122,206,671 (-) NCBI Rnor_5.0 3 127,809,688 - 127,822,296 (+) NCBI RGSC_v3.4 3 117,291,025 - 117,303,367 (-) RGD Celera 3 115,716,443 - 115,728,785 (-) RGD
Sequence:
GGAGTAAGGCTCACAGAACTGCCATAGGGGGATTTGGTAGCCTTCAAGGCTTCCTCTGTGGCACTTCTCTGAGCTAGCGTCAGGGCTCCTTCTGAATCTTGGATCGGCCATCCTATCACCTGATCAGC
hide sequence
RefSeq Acc Id:
NP_062247 ⟸ NM_019374
- Peptide Label:
preproprotein
- UniProtKB:
F1M7S3 (UniProtKB/TrEMBL), A6HQ68 (UniProtKB/TrEMBL)
- Sequence:
MAWSRLMLAACLLVIPSEVTADCLSLCSLCAVRTQDGPHPINPLICSLECQDLVPPSEEWETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTELTKLLEPLLKELEKGQLLTSVSEEKLRGLSSRF
hide sequence
Ensembl Acc Id:
ENSRNOP00000038921 ⟸ ENSRNOT00000037576
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Pdyn
prodynorphin
Name updated
70584 APPROVED
