Symbol:
Nnat
Name:
neuronatin
RGD ID:
620155
Description:
Involved in neuron differentiation. Located in cytoplasm. Orthologous to human NNAT (neuronatin); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC156562; neuronatin alpha; Peg5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NNAT (neuronatin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Nnat (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nnat (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NNAT (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NNAT (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nnat (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NNAT (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NNAT (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nnat (neuronatin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NNAT (neuronatin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nnat (neuronatin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 166,646,373 - 166,648,845 (+) NCBI GRCr8 mRatBN7.2 3 146,225,941 - 146,228,868 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,226,407 - 146,228,834 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,051,744 - 150,054,205 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 158,552,933 - 158,555,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 156,294,850 - 156,297,310 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,043,873 - 154,046,330 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 148,269,404 - 148,271,781 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,175,312 - 148,177,690 (+) NCBI Celera 3 144,930,375 - 144,932,836 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nnat Rat 17alpha-ethynylestradiol increases expression ISO RGD:730842 6480464 Ethinyl Estradiol results in increased expression of NNAT mRNA CTD PMID:17942748 Nnat Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of NNAT mRNA CTD PMID:15834898 Nnat Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:730842 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NNAT mRNA CTD PMID:17942748 Nnat Rat 17alpha-ethynylestradiol affects expression ISO RGD:730842 6480464 Ethinyl Estradiol affects the expression of NNAT mRNA CTD PMID:17555576 Nnat Rat 17beta-estradiol increases expression ISO RGD:730842 6480464 Estradiol results in increased expression of NNAT mRNA CTD PMID:19484750 Nnat Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NNAT mRNA CTD PMID:32145629 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:730841 6480464 Tetrachlorodibenzodioxin results in increased expression of NNAT mRNA CTD PMID:19684285 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NNAT mRNA CTD PMID:33387578 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NNAT mRNA CTD PMID:26232522 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:730842 6480464 Tetrachlorodibenzodioxin affects the expression of NNAT mRNA CTD PMID:21570461|PMID:24680724 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:730842 6480464 Tetrachlorodibenzodioxin results in increased expression of NNAT mRNA CTD PMID:17942748|PMID:19684285 Nnat Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:730842 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NNAT mRNA CTD PMID:17942748 Nnat Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:730842 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of NNAT mRNA CTD PMID:38648751 Nnat Rat 3,3',5-triiodo-L-thyronine decreases expression EXP 6480464 Triiodothyronine results in decreased expression of NNAT mRNA CTD PMID:29357290 Nnat Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:730842 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of NNAT mRNA CTD PMID:26251327 Nnat Rat 3,4-methylenedioxymethamphetamine increases methylation ISO RGD:730842 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased methylation of NNAT promoter CTD PMID:26251327 Nnat Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:730842 6480464 bisphenol S results in increased expression of NNAT mRNA CTD PMID:30951980 Nnat Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:730842 6480464 bisphenol S affects the methylation of NNAT exon CTD PMID:33297965 Nnat Rat 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 [Decitabine affects the methylation of NNAT protein] which affects the expression of NNAT mRNA CTD PMID:18381416 Nnat Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:730841 6480464 Decitabine results in increased expression of NNAT mRNA CTD PMID:17762496 Nnat Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NNAT mRNA CTD PMID:24780913 Nnat Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NNAT mRNA CTD PMID:31881176 Nnat Rat all-trans-retinoic acid decreases expression ISO RGD:730841 6480464 Tretinoin results in decreased expression of NNAT mRNA CTD PMID:21934132 Nnat Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NNAT mRNA CTD PMID:35163327 Nnat Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NNAT mRNA CTD PMID:16483693 Nnat Rat benzo[a]pyrene decreases expression ISO RGD:730842 6480464 Benzo(a)pyrene results in decreased expression of NNAT mRNA CTD PMID:22228805|PMID:27195522 Nnat Rat benzo[b]fluoranthene decreases expression ISO RGD:730842 6480464 benzo(b)fluoranthene results in decreased expression of NNAT mRNA CTD PMID:26377693 Nnat Rat Benzo[k]fluoranthene decreases expression ISO RGD:730842 6480464 benzo(k)fluoranthene results in decreased expression of NNAT mRNA CTD PMID:26377693 Nnat Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:730842 6480464 Diethylhexyl Phthalate results in increased expression of NNAT mRNA CTD PMID:33754040 Nnat Rat bis(2-ethylhexyl) phthalate increases methylation ISO RGD:730842 6480464 Diethylhexyl Phthalate results in increased methylation of NNAT gene CTD PMID:34319233 Nnat Rat bis(2-ethylhexyl) phthalate decreases methylation ISO RGD:730842 6480464 Diethylhexyl Phthalate results in decreased methylation of NNAT gene CTD PMID:38833407 Nnat Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NNAT mRNA CTD PMID:25181051|PMID:30816183 Nnat Rat bisphenol A increases expression ISO RGD:730842 6480464 bisphenol A results in increased expression of NNAT mRNA CTD PMID:38701888 Nnat Rat bisphenol A decreases expression ISO RGD:730842 6480464 bisphenol A results in decreased expression of NNAT mRNA CTD PMID:32926169 Nnat Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NNAT mRNA CTD PMID:32145629 Nnat Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NNAT gene CTD PMID:28505145 Nnat Rat bisphenol F increases expression ISO RGD:730842 6480464 bisphenol F results in increased expression of NNAT mRNA CTD PMID:30951980 Nnat Rat Butylbenzyl phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat carbamazepine affects expression ISO RGD:730841 6480464 Carbamazepine affects the expression of NNAT mRNA CTD PMID:25979313 Nnat Rat carbon nanotube increases expression ISO RGD:730842 6480464 Nanotubes, Carbon analog results in increased expression of NNAT mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Nnat Rat chlorpyrifos increases expression ISO RGD:730842 6480464 Chlorpyrifos results in increased expression of NNAT mRNA CTD PMID:37019170 Nnat Rat cisplatin increases expression ISO RGD:730841 6480464 Cisplatin results in increased expression of NNAT mRNA CTD PMID:27392435 Nnat Rat cisplatin multiple interactions ISO RGD:730841 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NNAT mRNA CTD PMID:27392435 Nnat Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of NNAT mRNA CTD PMID:26577399 Nnat Rat dexamethasone increases expression ISO RGD:730841 6480464 Dexamethasone results in increased expression of NNAT mRNA CTD PMID:25047013 Nnat Rat diazinon increases methylation ISO RGD:730841 6480464 Diazinon results in increased methylation of NNAT gene CTD PMID:22964155 Nnat Rat Dibutyl phosphate affects expression ISO RGD:730841 6480464 di-n-butylphosphoric acid affects the expression of NNAT mRNA CTD PMID:37042841 Nnat Rat dibutyl phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat diethyl phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat diisobutyl phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat diisononyl phthalate multiple interactions ISO RGD:730842 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Nnat Rat dioxygen increases expression ISO RGD:730841 6480464 Oxygen deficiency results in increased expression of NNAT mRNA CTD PMID:26516004 Nnat Rat dioxygen multiple interactions ISO RGD:730842 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of NNAT mRNA CTD PMID:30529165 Nnat Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of NNAT mRNA CTD PMID:25152437 Nnat Rat ellagic acid increases expression ISO RGD:730841 6480464 Ellagic Acid results in increased expression of NNAT mRNA CTD PMID:12002526 Nnat Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of NNAT mRNA CTD PMID:29391264 Nnat Rat ethanol multiple interactions ISO RGD:730841 6480464 [Ethanol co-treated with Folic Acid] results in decreased expression of NNAT mRNA CTD PMID:23378141 Nnat Rat ethanol affects splicing ISO RGD:730842 6480464 Ethanol affects the splicing of NNAT mRNA CTD PMID:30319688 Nnat Rat ethanol decreases expression ISO RGD:730841 6480464 Ethanol results in decreased expression of NNAT mRNA CTD PMID:23378141 Nnat Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of NNAT mRNA CTD PMID:18035473 Nnat Rat folic acid multiple interactions ISO RGD:730842 6480464 [Folic Acid co-treated with sodium arsenite] results in increased methylation of NNAT mRNA CTD PMID:22959928 Nnat Rat folic acid decreases expression ISO RGD:730842 6480464 Folic Acid results in decreased expression of NNAT mRNA CTD PMID:25629700 Nnat Rat folic acid multiple interactions ISO RGD:730841 6480464 [Ethanol co-treated with Folic Acid] results in decreased expression of NNAT mRNA CTD PMID:23378141 Nnat Rat furan increases methylation EXP 6480464 furan results in increased methylation of NNAT gene CTD PMID:22079235 Nnat Rat furan increases expression EXP 6480464 furan results in increased expression of NNAT mRNA CTD PMID:27387713 Nnat Rat gentamycin affects expression EXP 6480464 Gentamicins affects the expression of NNAT mRNA CTD PMID:33387578 Nnat Rat L-ascorbic acid increases expression ISO RGD:730842 6480464 Ascorbic Acid results in increased expression of NNAT mRNA CTD PMID:15305145 Nnat Rat lead(0) decreases methylation ISO RGD:730842 6480464 Lead results in decreased methylation of NNAT gene CTD PMID:38833407 Nnat Rat Licochalcone B increases expression ISO RGD:730841 6480464 licochalcone B results in increased expression of NNAT mRNA CTD PMID:33647349 Nnat Rat lidocaine decreases expression ISO RGD:730841 6480464 Lidocaine results in decreased expression of NNAT protein CTD PMID:34193770 Nnat Rat lidocaine decreases expression ISO RGD:730842 6480464 Lidocaine results in decreased expression of NNAT protein CTD PMID:34193770 Nnat Rat lidocaine multiple interactions ISO RGD:730841 6480464 NGF protein inhibits the reaction [Lidocaine results in decreased expression of NNAT protein]; NNAT protein more ... CTD PMID:34193770 Nnat Rat lidocaine multiple interactions ISO RGD:730842 6480464 NGF protein inhibits the reaction [Lidocaine results in decreased expression of NNAT protein]; NNAT protein more ... CTD PMID:34193770 Nnat Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NNAT mRNA CTD PMID:16026605|PMID:28801915 Nnat Rat N-methyl-4-phenylpyridinium increases methylation EXP 6480464 1-Methyl-4-phenylpyridinium results in increased methylation of NNAT gene CTD PMID:28801915 Nnat Rat N-methyl-N-nitrosourea decreases expression EXP 6480464 Methylnitrosourea results in decreased expression of NNAT mRNA CTD PMID:16525678 Nnat Rat naphthalene increases expression ISO RGD:730842 6480464 naphthalene results in increased expression of NNAT mRNA CTD PMID:18978301 Nnat Rat niclosamide decreases expression ISO RGD:730841 6480464 Niclosamide results in decreased expression of NNAT mRNA CTD PMID:36318118 Nnat Rat nigericin decreases response to substance EXP 6480464 NNAT protein results in decreased susceptibility to Nigericin CTD PMID:12101027 Nnat Rat nitroglycerin increases expression EXP 6480464 Nitroglycerin results in increased expression of NNAT mRNA CTD PMID:12102619 Nnat Rat ozone multiple interactions ISO RGD:730842 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Nnat Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of NNAT mRNA CTD PMID:32680482 Nnat Rat perfluorohexanesulfonic acid increases expression ISO RGD:730842 6480464 perfluorohexanesulfonic acid results in increased expression of NNAT mRNA CTD PMID:37995155 Nnat Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NNAT mRNA CTD PMID:35163327 Nnat Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of NNAT mRNA CTD PMID:15215175 Nnat Rat pirinixic acid increases expression ISO RGD:730842 6480464 pirinixic acid results in increased expression of NNAT mRNA CTD PMID:20813756 Nnat Rat resveratrol multiple interactions ISO RGD:730841 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of NNAT mRNA CTD PMID:23557933 Nnat Rat rotenone decreases response to substance EXP 6480464 NNAT protein results in decreased susceptibility to Rotenone CTD PMID:12101027 Nnat Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of NNAT mRNA CTD PMID:27900601|PMID:28374803 Nnat Rat sodium arsenate decreases expression ISO RGD:730842 6480464 sodium arsenate results in decreased expression of NNAT mRNA CTD PMID:21795629 Nnat Rat sodium arsenite multiple interactions ISO RGD:730842 6480464 [Folic Acid co-treated with sodium arsenite] results in increased methylation of NNAT mRNA CTD PMID:22959928 Nnat Rat sodium arsenite decreases expression ISO RGD:730842 6480464 sodium arsenite results in decreased expression of NNAT mRNA CTD PMID:37682722 Nnat Rat Soman increases expression EXP 6480464 Soman results in increased expression of NNAT mRNA CTD PMID:19281266 Nnat Rat tamoxifen affects expression ISO RGD:730842 6480464 Tamoxifen affects the expression of NNAT mRNA CTD PMID:17555576 Nnat Rat tetrachloromethane affects expression ISO RGD:730842 6480464 Carbon Tetrachloride affects the expression of NNAT mRNA CTD PMID:17484886 Nnat Rat tetrachloromethane increases expression ISO RGD:730842 6480464 Carbon Tetrachloride results in increased expression of NNAT mRNA CTD PMID:27339419 Nnat Rat thapsigargin decreases expression ISO RGD:730841 6480464 Thapsigargin results in decreased expression of NNAT mRNA CTD PMID:22378314 Nnat Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NNAT mRNA CTD PMID:34492290 Nnat Rat titanium dioxide increases methylation ISO RGD:730842 6480464 titanium dioxide results in increased methylation of NNAT gene CTD PMID:35295148 Nnat Rat trimellitic anhydride increases expression ISO RGD:730842 6480464 trimellitic anhydride results in increased expression of NNAT mRNA CTD PMID:19042947 Nnat Rat triptonide increases expression ISO RGD:730842 6480464 triptonide results in increased expression of NNAT mRNA CTD PMID:33045310 Nnat Rat trovafloxacin increases expression ISO RGD:730842 6480464 trovafloxacin results in increased expression of NNAT mRNA CTD PMID:35537566 Nnat Rat tunicamycin decreases expression ISO RGD:730841 6480464 Tunicamycin results in decreased expression of NNAT mRNA CTD PMID:22378314 Nnat Rat valinomycin decreases response to substance EXP 6480464 NNAT protein results in decreased susceptibility to Valinomycin CTD PMID:12101027 Nnat Rat valproic acid increases expression ISO RGD:730841 6480464 Valproic Acid results in increased expression of NNAT mRNA CTD PMID:24849673
17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5-triiodo-L-thyronine (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) Cuprizon (EXP) dexamethasone (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) diuron (EXP) ellagic acid (ISO) endosulfan (EXP) ethanol (ISO) flavonoids (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) L-ascorbic acid (ISO) lead(0) (ISO) Licochalcone B (ISO) lidocaine (ISO) N-methyl-4-phenylpyridinium (EXP) N-methyl-N-nitrosourea (EXP) naphthalene (ISO) niclosamide (ISO) nigericin (EXP) nitroglycerin (EXP) ozone (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) PhIP (EXP) pirinixic acid (ISO) resveratrol (ISO) rotenone (EXP) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) tamoxifen (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triptonide (ISO) trovafloxacin (ISO) tunicamycin (ISO) valinomycin (EXP) valproic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Molecular cloning of a novel mRNA (neuronatin) that is highly expressed in neonatal mammalian brain.
Joseph R, etal., Biochem Biophys Res Commun 1994 Jun 30;201(3):1227-34.
4.
Neuronatin mRNA: alternatively spliced forms of a novel brain-specific mammalian developmental gene.
Joseph R, etal., Brain Res 1995 Aug 28;690(1):92-8.
5.
Neuronatin mRNA in PC12 cells: downregulation by nerve growth factor.
Joseph R, etal., Brain Res 1996 Oct 28;738(1):32-8.
6.
Dynamic Changes in the Localization of Neuronatin-Positive Cells during Neurogenesis in the Embryonic Rat Brain.
Kanno N, etal., Cells Tissues Organs. 2019;207(3-4):127-137. doi: 10.1159/000504359. Epub 2019 Dec 5.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Identification of cell-specific messenger ribonucleic acids in oxytocinergic and vasopressinergic magnocellular neurons in rat supraoptic nucleus by single-cell differential hybridization.
Yamashita M, etal., Endocrinology 2002 Nov;143(11):4464-76.
Nnat Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 166,646,373 - 166,648,845 (+) NCBI GRCr8 mRatBN7.2 3 146,225,941 - 146,228,868 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 146,226,407 - 146,228,834 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 150,051,744 - 150,054,205 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 158,552,933 - 158,555,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 156,294,850 - 156,297,310 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 154,043,873 - 154,046,330 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 148,269,404 - 148,271,781 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 148,175,312 - 148,177,690 (+) NCBI Celera 3 144,930,375 - 144,932,836 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
NNAT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 37,521,250 - 37,523,690 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 37,521,206 - 37,523,690 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 36,149,652 - 36,152,092 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 35,583,021 - 35,585,506 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 35,583,020 - 35,585,502 NCBI Celera 20 32,856,869 - 32,859,355 (+) NCBI Celera Cytogenetic Map 20 q11.23 NCBI HuRef 20 32,885,325 - 32,887,812 (+) NCBI HuRef CHM1_1 20 36,052,423 - 36,054,893 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 39,245,345 - 39,247,787 (+) NCBI T2T-CHM13v2.0
Nnat Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 157,401,936 - 157,404,445 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 157,401,998 - 157,404,442 (+) Ensembl GRCm39 Ensembl GRCm38 2 157,560,078 - 157,562,525 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 157,560,078 - 157,562,522 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 157,385,846 - 157,388,258 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 157,251,564 - 157,253,945 (+) NCBI MGSCv36 mm8 Celera 2 163,504,157 - 163,506,569 (+) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 78.4 NCBI
Nnat Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 19,121,164 - 19,125,514 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 19,121,164 - 19,125,514 (-) NCBI ChiLan1.0 ChiLan1.0
NNAT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 43,246,341 - 43,251,217 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 43,239,925 - 43,244,315 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 33,842,071 - 33,845,575 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 34,955,233 - 34,959,493 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 34,955,234 - 34,959,493 (+) Ensembl panpan1.1 panPan2
NNAT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 26,119,153 - 26,121,573 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 26,118,991 - 26,120,906 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 25,764,843 - 25,767,256 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 26,815,822 - 26,818,235 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 26,815,835 - 26,817,449 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 26,091,104 - 26,093,520 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 26,198,494 - 26,200,910 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 26,686,053 - 26,688,469 (+) NCBI UU_Cfam_GSD_1.0
Nnat Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 175,007,353 - 175,009,820 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936561 3,739,664 - 3,742,154 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936561 3,739,664 - 3,744,015 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NNAT
NNAT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 26,229,765 - 26,232,249 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 26,230,696 - 26,232,127 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 75,102,293 - 75,105,653 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nnat
.
Predicted Target Of
Count of predictions: 787 Count of miRNA genes: 252 Interacting mature miRNAs: 321 Transcripts: ENSRNOT00000034166, ENSRNOT00000068863, ENSRNOT00000072502 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1300113 Bp176 Blood pressure QTL 176 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145956084 157309487 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 61335 Bp20 Blood pressure QTL 20 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141339236 155617360 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1598854 Memor10 Memory QTL 10 2 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 3 145956084 161299569 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
BI286603
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,228,606 - 146,228,775 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,046,073 - 154,046,241 NCBI Rnor6.0 Rnor_5.0 3 161,553,451 - 161,553,619 UniSTS Rnor5.0 RGSC_v3.4 3 148,271,523 - 148,271,691 UniSTS RGSC3.4 Celera 3 144,932,575 - 144,932,743 UniSTS RH 3.4 Map 3 1352.6 UniSTS Cytogenetic Map 3 q42 UniSTS
AA858569
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,228,607 - 146,228,827 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,046,074 - 154,046,293 NCBI Rnor6.0 Rnor_5.0 3 161,553,399 - 161,553,618 UniSTS Rnor5.0 RGSC_v3.4 3 148,271,524 - 148,271,743 UniSTS RGSC3.4 Celera 3 144,932,576 - 144,932,795 UniSTS RH 3.4 Map 3 1353.3 UniSTS Cytogenetic Map 3 q42 UniSTS
BF413147
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 166,648,127 - 166,648,279 (+) Marker Load Pipeline mRatBN7.2 3 146,228,150 - 146,228,302 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,045,617 - 154,045,768 NCBI Rnor6.0 Rnor_5.0 3 161,553,924 - 161,554,075 UniSTS Rnor5.0 RGSC_v3.4 3 148,271,067 - 148,271,218 UniSTS RGSC3.4 Celera 3 144,932,119 - 144,932,270 UniSTS RH 3.4 Map 3 1354.1 UniSTS Cytogenetic Map 3 q42 UniSTS
BI281696
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,228,368 - 146,228,531 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,045,835 - 154,045,997 NCBI Rnor6.0 Rnor_5.0 3 161,553,695 - 161,553,857 UniSTS Rnor5.0 RGSC_v3.4 3 148,271,285 - 148,271,447 UniSTS RGSC3.4 Celera 3 144,932,337 - 144,932,499 UniSTS RH 3.4 Map 3 1352.3 UniSTS Cytogenetic Map 3 q42 UniSTS
Nnat
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,228,077 - 146,228,693 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,045,544 - 154,046,159 NCBI Rnor6.0 Rnor_5.0 3 161,553,533 - 161,554,148 UniSTS Rnor5.0 RGSC_v3.4 3 148,270,994 - 148,271,609 UniSTS RGSC3.4 Celera 3 144,932,046 - 144,932,661 UniSTS Cytogenetic Map 3 q42 UniSTS
Nnat
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 146,228,502 - 146,228,697 (+) MAPPER mRatBN7.2 Rnor_6.0 3 154,045,969 - 154,046,163 NCBI Rnor6.0 Rnor_5.0 3 161,553,529 - 161,553,723 UniSTS Rnor5.0 RGSC_v3.4 3 148,271,419 - 148,271,613 UniSTS RGSC3.4 Celera 3 144,932,471 - 144,932,665 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034166 ⟹ ENSRNOP00000034212
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,226,416 - 146,228,834 (+) Ensembl Rnor_6.0 Ensembl 3 154,043,873 - 154,046,330 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000072502 ⟹ ENSRNOP00000064325
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,226,407 - 146,228,834 (+) Ensembl Rnor_6.0 Ensembl 3 154,043,873 - 154,046,330 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098078 ⟹ ENSRNOP00000096996
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 146,226,416 - 146,228,108 (+) Ensembl
RefSeq Acc Id:
NM_001270867 ⟹ NP_001257796
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,384 - 166,648,845 (+) NCBI mRatBN7.2 3 146,226,407 - 146,228,868 (+) NCBI Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI Celera 3 144,930,375 - 144,932,836 (+) NCBI
Sequence:
GTGGCAGGAGGGTACTTAAGGCGCGGCCACCGGGGCTGCGGCATTGCGCCCAGCAGCGGACTCCGAGATCCATAGACCTCGGCGAACCCTTGCTCTCGACCACCCACCCACTTTCGGAACCATGGCCG
hide sequence
RefSeq Acc Id:
NM_053601 ⟹ NP_446053
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,384 - 166,648,845 (+) NCBI mRatBN7.2 3 146,226,407 - 146,228,868 (+) NCBI Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI RGSC_v3.4 3 148,269,404 - 148,271,781 (+) RGD Celera 3 144,930,375 - 144,932,836 (+) NCBI
Sequence:
GTGGCAGGAGGGTACTTAAGGCGCGGCCACCGGGGCTGCGGCATTGCGCCCAGCAGCGGACTCCGAGATCCATAGACCTCGGCGAACCCTTGCTCTCGACCACCCACCCACTTTCGGAACCATGGCCG
hide sequence
RefSeq Acc Id:
NM_181687 ⟹ NP_859015
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,384 - 166,648,845 (+) NCBI mRatBN7.2 3 146,226,407 - 146,228,868 (+) NCBI Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI RGSC_v3.4 3 148,269,404 - 148,271,781 (+) RGD Celera 3 144,930,375 - 144,932,836 (+) NCBI
Sequence:
GTGGCAGGAGGGTACTTAAGGCGCGGCCACCGGGGCTGCGGCATTGCGCCCAGCAGCGGACTCC
hide sequence
RefSeq Acc Id:
NR_073089
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,384 - 166,648,845 (+) NCBI mRatBN7.2 3 146,226,407 - 146,228,868 (+) NCBI Rnor_6.0 3 154,043,873 - 154,046,334 (+) NCBI Rnor_5.0 3 161,553,358 - 161,557,429 (-) NCBI Celera 3 144,930,375 - 144,932,836 (+) NCBI
Sequence:
GTGGCAGGAGGGTACTTAAGGCGCGGCCACCGGGGCTGCGGCATTGCGCCCAGCAGCGGACTCCGAGATCCATAGACCTCGGCGAACCCTTGCTCTCGACCACCCACCCACTTTCGGAACCATGGCCG
hide sequence
RefSeq Acc Id:
XM_008762390 ⟹ XP_008760612
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,383 - 166,648,845 (+) NCBI mRatBN7.2 3 146,225,941 - 146,228,868 (+) NCBI Rnor_6.0 3 154,043,878 - 154,045,574 (+) NCBI
Sequence:
AGGAGGGTACTTAAGGCGCGGCCACCGGGGCTGCGGCATTGCGCCCAGCAGCGGACTCCGAGATCCATAGACCTCGGCGAACCCTTGCTCTCGACCACCCACCCACTTTCGGAACCATGGCCGCAGTG
hide sequence
RefSeq Acc Id:
XM_063284795 ⟹ XP_063140865
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 166,646,373 - 166,648,845 (+) NCBI
RefSeq Acc Id:
NP_446053 ⟸ NM_053601
- Peptide Label:
isoform alpha
- UniProtKB:
A0JPK6 (UniProtKB/Swiss-Prot), Q62663 (UniProtKB/Swiss-Prot), Q62649 (UniProtKB/Swiss-Prot)
- Sequence:
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAHTVSRTGRQVLGERRHRAPN
hide sequence
RefSeq Acc Id:
NP_859015 ⟸ NM_181687
- Peptide Label:
isoform beta
- UniProtKB:
Q62649 (UniProtKB/Swiss-Prot)
- Sequence:
MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAHTVSRTGRQVLGERRHRAPN
hide sequence
RefSeq Acc Id:
NP_001257796 ⟸ NM_001270867
- Peptide Label:
isoform 3
- UniProtKB:
Q62649 (UniProtKB/Swiss-Prot)
- Sequence:
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVFRYSLQKLAHTVSRTGRQVLGERRHRAPN
hide sequence
RefSeq Acc Id:
XP_008760612 ⟸ XM_008762390
- Peptide Label:
isoform X2
- Sequence:
MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSVQVLPAEAGAHGVPDRAAGAGGAQAPSPQLRPHLPALGGRVIRCSCASRPAWEPMPRRNGGSPVLPRQRSTCQGQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000064325 ⟸ ENSRNOT00000072502
Ensembl Acc Id:
ENSRNOP00000034212 ⟸ ENSRNOT00000034166
Ensembl Acc Id:
ENSRNOP00000096996 ⟸ ENSRNOT00000098078
RefSeq Acc Id:
XP_063140865 ⟸ XM_063284795
- Peptide Label:
isoform X1
RGD ID: 13692613 Promoter ID: EPDNEW_R3138 Type: single initiation site Name: Nnat_1 Description: neuronatin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 154,043,915 - 154,043,975 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Nnat
neuronatin
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Nnat
neuronatin
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
preferentially found in vasopressin (VP)-expressing magnocellular neurons (MCNs)
628363
gene_expression
expressed in thyroid tumors
628363
gene_expression
strongly expressed in neonatal rat brain, with a subsequent decreased expression in juveniles and adults; expressed in endocrine cells, including pancreatic b-cells and PC-12 cells
628363
gene_homology
homologous to PMP-1, an H+-ATPase subunit
628363
gene_mapping
gene maps to distal chromosome 2 in an imprinting region where mutations can lead to developmental abnormalities
628363
gene_process
may mediate regulation of ions during brain development
628363
gene_protein
54 and 81 kDa
628363
gene_protein
81 amino acids
729024
gene_regulation
gene is paternally expressed and imprinted
628363
gene_transcript
contains three exons producing two alternatively spliced mRNA
628363
