Syt6 (synaptotagmin 6) - Rat Genome Database

Name: Syt6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Syt6 (synaptotagmin 6) Rattus norvegicus

Analyze

Symbol:

Syt6

Name:

synaptotagmin 6

RGD ID:

62012

Description:

Enables syntaxin binding activity. Involved in postsynaptic dense core vesicle exocytosis. Is active in glutamatergic synapse and synaptic membrane. Orthologous to human SYT6 (synaptotagmin 6); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC116356; synaptotagmin VI; synaptotagmin-6; sytVI

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SYT6 (synaptotagmin 6)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Syt6 (synaptotagmin VI)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Syt6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SYT6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SYT6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Syt6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SYT6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SYT6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Syt6 (synaptotagmin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Syt6 (synaptotagmin VI)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SYT6 (synaptotagmin 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	syt6b (synaptotagmin VIb)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	syt6a (synaptotagmin VIa)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snt-5	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	syt6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	191,093,009 - 191,152,283 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	191,093,007 - 191,149,956 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	198,690,257 - 198,749,449 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	196,562,984 - 196,622,178 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	191,379,964 - 191,439,147 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	206,064,181 - 206,119,034 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	206,064,179 - 206,127,907 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	225,492,367 - 225,547,221 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	198,807,340 - 198,862,227 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	198,770,093 - 198,824,981 (+)	NCBI
Celera	2	183,565,789 - 183,620,107 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

breast ductal carcinoma (ISO)

genetic disease (ISO)

hereditary spastic paraplegia 47 (ISO)

Hoyeraal Hreidarsson Syndrome (ISO)

RASopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

6-propyl-2-thiouracil (EXP)

Aflatoxin B2 alpha (ISO)

ammonium chloride (EXP)

androgen antagonist (EXP)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylparaben (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

clofibrate (ISO)

Cuprizon (EXP)

dorsomorphin (ISO)

enzacamene (EXP)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

hydralazine (ISO)

methapyrilene (ISO)

N-methyl-4-phenylpyridinium (ISO)

paracetamol (EXP,ISO)

phenylmercury acetate (ISO)

rotenone (ISO)

SB 431542 (ISO)

Testosterone propionate (ISO)

thimerosal (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acrosomal vesicle exocytosis (ISO)

acrosome reaction (ISO)

calcium-ion regulated exocytosis (IBA)

cellular response to calcium ion (IBA)

postsynaptic dense core vesicle exocytosis (IDA,IMP)

regulation of calcium ion-dependent exocytosis (IBA)

regulation of dopamine secretion (IBA)

Cellular Component

cytosol (ISO,ISS)

extrinsic component of membrane (ISO,ISS)

glutamatergic synapse (IDA,IMP)

membrane (IEA,ISO,ISS)

perinuclear endoplasmic reticulum (ISO)

plasma membrane (ISO,ISS)

postsynapse (IEA)

synaptic membrane (EXP,IDA,IEP)

synaptic vesicle membrane (IEA)

Molecular Function

calcium ion binding (IBA)

calcium-dependent phospholipid binding (IBA,ISO)

calcium-dependent protein binding (ISO)

clathrin binding (IBA,ISO)

identical protein binding (ISO)

phosphatidylserine binding (IBA,ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

syntaxin binding (IBA,IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The subcellular localizations of atypical synaptotagmins III and VI. Synaptotagmin III is enriched in synapses and synaptic plasma membranes but not in synaptic vesicles.	Butz S, etal., J Biol Chem. 1999 Jun 25;274(26):18290-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.	Li C, etal., Nature 1995 Jun 15;375(6532):594-9.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
10.	Activity-dependent BDNF release via endocytic pathways is regulated by synaptotagmin-6 and complexin.	Wong YH, etal., Proc Natl Acad Sci U S A. 2015 Aug 11;112(32):E4475-84. doi: 10.1073/pnas.1511830112. Epub 2015 Jul 27.

Additional References at PubMed

PMID:8626542	PMID:10531343	PMID:10531344	PMID:10556508	PMID:11437455	PMID:12477932	PMID:12860971	PMID:15774481

Genomics

Comparative Map Data

Syt6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	191,093,009 - 191,152,283 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	191,093,007 - 191,149,956 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	198,690,257 - 198,749,449 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	196,562,984 - 196,622,178 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	191,379,964 - 191,439,147 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	206,064,181 - 206,119,034 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	206,064,179 - 206,127,907 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	225,492,367 - 225,547,221 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	198,807,340 - 198,862,227 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	198,770,093 - 198,824,981 (+)	NCBI
Celera	2	183,565,789 - 183,620,107 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

SYT6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	114,089,292 - 114,153,869 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	114,089,291 - 114,153,880 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	114,631,914 - 114,696,491 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	114,433,437 - 114,497,995 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	114,346,428 - 114,408,514	NCBI
Celera	1	112,861,141 - 112,925,712 (-)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	112,489,973 - 112,554,564 (-)	NCBI		HuRef
CHM1_1	1	114,746,727 - 114,811,584 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	114,100,938 - 114,165,509 (-)	NCBI		T2T-CHM13v2.0

Syt6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	103,482,561 - 103,552,883 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	103,482,547 - 103,552,885 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	103,575,245 - 103,645,567 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	103,575,231 - 103,645,569 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	103,379,204 - 103,439,102 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	103,704,342 - 103,764,239 (+)	NCBI		MGSCv36	mm8
Celera	3	105,781,488 - 105,842,192 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI

Syt6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	17,347,011 - 17,405,526 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	17,349,971 - 17,405,526 (-)	NCBI	ChiLan1.0	ChiLan1.0

SYT6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	106,342,558 - 106,412,360 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	88,397,809 - 88,467,493 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	123,453,698 - 123,514,804 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	123,452,889 - 123,514,795 (+)	Ensembl	panpan1.1		panPan2

SYT6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	51,859,564 - 51,923,044 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	51,864,774 - 51,924,676 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	51,509,928 - 51,574,570 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	52,737,130 - 52,791,129 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	52,740,102 - 52,799,079 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	51,744,089 - 51,808,674 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	51,815,566 - 51,877,205 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	52,385,301 - 52,449,966 (-)	NCBI		UU_Cfam_GSD_1.0

Syt6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	14,979,103 - 15,042,151 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936690	2,435,541 - 2,497,553 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936690	2,435,573 - 2,497,332 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SYT6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	106,425,632 - 106,485,468 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	106,420,614 - 106,485,468 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	116,560,038 - 116,622,295 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SYT6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	19,497,218 - 19,561,621 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	19,512,540 - 19,563,038 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	22,260,659 - 22,330,080 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Syt6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	9,753,416 - 9,810,757 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	9,753,485 - 9,810,815 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Syt6
374 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	93
Interacting mature miRNAs:	100
Transcripts:	ENSRNOT00000025953
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
7488929	Bp366	Blood pressure QTL 366		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	184974550	193094998	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	190602746	192625452	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	190602746	192625452	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat

Markers in Region

RH142700

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	191,119,471 - 191,119,643 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	206,090,642 - 206,090,813	NCBI	Rnor6.0
Rnor_5.0	2	225,518,828 - 225,518,999	UniSTS	Rnor5.0
RGSC_v3.4	2	198,833,801 - 198,833,972	UniSTS	RGSC3.4
RH 3.4 Map	2	1324.1	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			8		8				52	14	4
Low	2	17	1						22	4	24	11
Below cutoff	1	26	21	17	7	17	8	10		16	11		8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005500358	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005500359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005500360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U20105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y19241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000025953 ⟹ ENSRNOP00000025953

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	191,093,007 - 191,144,558 (+)	Ensembl
Rnor_6.0 Ensembl	2	206,064,179 - 206,119,034 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077739 ⟹ ENSRNOP00000069764

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	191,094,003 - 191,149,953 (+)	Ensembl
Rnor_6.0 Ensembl	2	206,064,394 - 206,127,907 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094540 ⟹ ENSRNOP00000081725

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	191,093,007 - 191,149,956 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114478 ⟹ ENSRNOP00000090316

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	191,094,130 - 191,149,953 (+)	Ensembl

RefSeq Acc Id:

NM_022191 ⟹ NP_071527

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,093,009 - 191,152,283 (+)	NCBI
Rnor_6.0	2	206,064,181 - 206,119,034 (+)	NCBI
Rnor_5.0	2	225,492,367 - 225,547,221 (+)	NCBI
RGSC_v3.4	2	198,807,340 - 198,862,227 (+)	RGD
Celera	2	183,565,789 - 183,620,107 (+)	RGD

Sequence:

show sequence

TTGAAAAGAAAGAAAAAAGTGATTTCTATGGAGTTGGGACTTGAAACCCAAGACCTACATACGA
CATGTTAACCAAGAGTTCCCCATTGACCTATATATACCCTAGCTCAAGGAACAGTGGATGAATA
ATAGATATTTGGGGGGACCCTGCGGGGAAGTGATTAAAAGCAGAGCCGAGCCTCAGGGGGCCGC
CGCGGGGAGGGTCTTTTGGGGGCCTCCTTGCCCCGCCCCAGTCCGGCCGCGGCTAGAGTTCGAG
TCACTGCTCCGCAGCCCTGAGGATCCGGGGCATGAGCGGAGTTTGGGGGGCCGGAGGGCCTCGG
TGCCAGGCGGCGCTCGCGGTCCTGGCCTCTCTGTGCCGGGCCCGGCCGCCCCCTCTCGGGCTGG
ACGTGGAGACTTGTCAGAGCTTCGAGCTGCAGCCCCCGGAGCAGAGTCCAAGCGCGGCCGACTC
AGGCACCTCTGTCAGCCTCCTCGCAGTGGTAGTTATTGTGTGTGGTGTGGCCCTGGTGGCAGTT
TTTTTCTTTCTCTTTTGGAAGCTGTGCTGGATGCCCTGGAGGAACAAGGAGGCCTCCAGCCCTT
CTTCTGCTAACCCTGCTTCAGAGATCCTCCAAAGCCCCAGCTCCAGAGGCAACATGGCGGATAA
GCTGAAGGACCCCAGTGCCCTGGGCTTCCTGGAGGCAGCTGTAAAGATCAGCCATACTTCCCCA
GATATCCCAGCCGAGGTGCAGATGTCGGTCAAAGAGCACATTATGCGCCACACCAAACTGCAGC
GACAGACCACAGAGCCAGCGTCGTCTACCAGACACACGTCCTTCAAGCGCCACCTGCCACGGCA
GATGCATGTCTCCAGTGTGGACTACGGCAATGAACTGCCGCCGGCCGCCGCTGAACAGCCCACC
AGTATTGGCCGTATCAAGCCTGAGCTCTACAAGCAGAAGTCAGTGGATGGGGATGAGGCCAAGT
CTGAGGCCGCCAAGAGCTGTGGGAAGATCAACTTCAGCCTCCGCTATGACTATGAGAGTGAGAC
CCTGATTGTACGAATCCTGAAGGCCTTTGACCTCCCTGCCAAGGACTTTTGTGGAAGTTCTGAC
CCTTACGTTAAAATCTACCTCTTGCCTGACCGCAAGTGCAAGCTGCAGACCCGGGTGCACCGCA
AGACGCTGAACCCCACCTTTGATGAGAACTTCCACTTCCCCGTGCCCTATGAGGAGCTGGCTGA
CCGCAAGCTGCATCTCAGTGTCTTTGACTTTGACCGCTTCTCCCGCCATGACATGATTGGCGAG
GTCATCCTGGACAATCTCTTCGAGGCCTCTGACCTGTCCCGGGAGACCTCCATCTGGAAGGACA
TCCAGTACGCTACTAGTGAAAGTGTGGACTTGGGAGAGATCATGTTCTCCCTCTGCTACCTGCC
CACAGCAGGCAGGCTCACCCTCACGGTGATCAAGTGTCGCAATCTCAAAGCAATGGATATCACG
GGCTACTCAGATCCCTACGTCAAAGTGTCCCTACTATGTGATGGGCGGAGACTGAAAAAGAAGA
AAACAACCATAAAAAAGAACACCCTCAACCCTGTCTACAACGAGGCCATCATCTTTGATATCCC
CCCAGAAAACATGGATCAAGTGAGCCTGCTCATCTCCGTTATGGACTATGACAGAGTTGGCCAC
AACGAGATCATAGGAGTGTGTAGAGTGGGGATCAGTGCTGAAGGTCTTGGCAGGGACCACTGGA
ATGAGATGTTGGCATACCCACGAAAGCCCATCGCACACTGGCACTGCTTGGCGGAGGTAAAGAA
ATCCTTCAAAGAGGGAACCCCCCGGTTGTGATTTCATTCACGTGGATGCTGCAAGCGG

hide sequence

RefSeq Acc Id:

XM_039103019 ⟹ XP_038958947

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,094,269 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XM_039103020 ⟹ XP_038958948

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,093,057 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XM_039103021 ⟹ XP_038958949

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,094,269 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XM_039103022 ⟹ XP_038958950

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,093,114 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XM_039103023 ⟹ XP_038958951

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,093,562 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XR_005500358

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,094,272 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XR_005500359

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,094,271 - 191,152,283 (+)	NCBI

RefSeq Acc Id:

XR_005500360

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	191,093,566 - 191,152,283 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071527	(Get FASTA)	NCBI Sequence Viewer
	XP_038958947	(Get FASTA)	NCBI Sequence Viewer
	XP_038958948	(Get FASTA)	NCBI Sequence Viewer
	XP_038958949	(Get FASTA)	NCBI Sequence Viewer
	XP_038958950	(Get FASTA)	NCBI Sequence Viewer
	XP_038958951	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA87724	(Get FASTA)	NCBI Sequence Viewer
	AAH99185	(Get FASTA)	NCBI Sequence Viewer
	EDL85482	(Get FASTA)	NCBI Sequence Viewer
	EDL85483	(Get FASTA)	NCBI Sequence Viewer
	EDL85484	(Get FASTA)	NCBI Sequence Viewer
	EDL85485	(Get FASTA)	NCBI Sequence Viewer
	Q62746	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_071527 ⟸ NM_022191

- UniProtKB:

Q4KLI6 (UniProtKB/Swiss-Prot), Q62746 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCQSFELQPPEQSPSAADSGTSVSLLAVV
VIVCGVALVAVFFFLFWKLCWMPWRNKEASSPSSANPASEILQSPSSRGNMADKLKDPSALGFL
EAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGN
ELPPAAAEQPTSIGRIKPELYKQKSVDGDEAKSEAAKSCGKINFSLRYDYESETLIVRILKAFD
LPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDF
DRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVI
KCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLL
ISVMDYDRVGHNEIIGVCRVGISAEGLGRDHWNEMLAYPRKPIAHWHCLAEVKKSFKEGTPRL

hide sequence

RefSeq Acc Id:

ENSRNOP00000069764 ⟸ ENSRNOT00000077739

RefSeq Acc Id:

ENSRNOP00000025953 ⟸ ENSRNOT00000025953

RefSeq Acc Id:	XP_038958948 ⟸ XM_039103020
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038958950 ⟸ XM_039103022
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038958951 ⟸ XM_039103023
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038958947 ⟸ XM_039103019
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038958949 ⟸ XM_039103021
- Peptide Label:	isoform X3

RefSeq Acc Id:

ENSRNOP00000081725 ⟸ ENSRNOT00000094540

RefSeq Acc Id:

ENSRNOP00000090316 ⟸ ENSRNOT00000114478

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62746-F1-model_v2	AlphaFold	Q62746	1-511	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:62012	AgrOrtholog
BIND	130563
	130911
	130912
	130913
BioCyc Gene	G2FUF-51813	BioCyc
Ensembl Genes	ENSRNOG00000019163	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000025953	ENTREZGENE
	ENSRNOP00000025953.6	UniProtKB/TrEMBL
	ENSRNOP00000069764	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000069764.2	UniProtKB/Swiss-Prot
	ENSRNOP00000081725	ENTREZGENE
	ENSRNOP00000081725.1	UniProtKB/TrEMBL
	ENSRNOP00000090316.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025953	ENTREZGENE
	ENSRNOT00000025953.6	UniProtKB/TrEMBL
	ENSRNOT00000077739	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000077739.2	UniProtKB/Swiss-Prot
	ENSRNOT00000094540	ENTREZGENE
	ENSRNOT00000094540.1	UniProtKB/TrEMBL
	ENSRNOT00000114478	ENTREZGENE
	ENSRNOT00000114478.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7383303	IMAGE-MGC_LOAD
InterPro	C2_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C2_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Synaptotagmin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60565	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116356	IMAGE-MGC_LOAD
NCBI Gene	60565	ENTREZGENE
PANTHER	PTHR10024:SF45	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOTAGMIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PF00168	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Syt6	PhenoGen
PRINTS	C2DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SYNAPTOTAGMN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	PS50004	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00239	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49562	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC235357
UniProt	A0A0G2JW68_RAT	UniProtKB/TrEMBL
	A0A8I6ABK1_RAT	UniProtKB/TrEMBL
	A0A8L2QEQ5_RAT	UniProtKB/TrEMBL
	Q4KLI6	ENTREZGENE
	Q62746	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q4KLI6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Syt6	synaptotagmin 6	Syt6	synaptotagmin VI	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Syt6	synaptotagmin VI		synaptotagmin 6	Name updated	1299863	APPROVED
2002-06-10	Syt6	synaptotagmin 6			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	specifically expressed in brain	61762
gene_function	bind clathrin-AP2 with high affinity	61762
gene_process	play a general role in endocytosis	61762

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar