Symbol:
Tgfbi
Name:
transforming growth factor, beta induced
RGD ID:
620017
Description:
Predicted to enable several functions, including collagen binding activity; extracellular matrix binding activity; and identical protein binding activity. Involved in chondrocyte differentiation. Located in basement membrane. Biomarker of kidney disease. Human ortholog(s) of this gene implicated in corneal dystrophy (multiple). Orthologous to human TGFBI (transforming growth factor beta induced); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Big-h3; BIGH3; transforming growth factor, beta induced, 68 kDa; transforming growth factor-beta-induced protein ig-h3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TGFBI (transforming growth factor beta induced) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Tgfbi (transforming growth factor, beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tgfbi (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TGFBI (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TGFBI (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tgfbi (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TGFBI (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TGFBI (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tgfbi (transforming growth factor beta induced) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TGFBI (transforming growth factor beta induced)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tgfbi (transforming growth factor, beta induced)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tgfbi (transforming growth factor, beta-induced)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F26E4.7
Alliance
DIOPT (Ensembl Compara|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
mfas
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):
YLR001C
Alliance
DIOPT (Hieranoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
tgfbi
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 7,960,885 - 7,990,234 (-) NCBI GRCr8 mRatBN7.2 17 7,955,603 - 7,984,903 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 7,955,603 - 7,985,240 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 7,973,969 - 8,002,492 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 9,505,209 - 9,534,325 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 7,970,355 - 7,998,883 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 8,400,123 - 8,429,338 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 8,400,146 - 8,429,338 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 10,576,347 - 10,605,606 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 13,904,882 - 13,935,110 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 13,907,546 - 13,912,997 (-) NCBI Celera 17 8,049,686 - 8,078,886 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Tgfbi Rat corneal dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Corneal Dystrophy, Dominant | ClinVar Annotator: match by term: Corneal more ... ClinVar PMID:10832717|PMID:11004271|PMID:11024425|PMID:11923233|PMID:12400061|PMID:15177960|PMID:16652336|PMID:16670477|PMID:16809844|PMID:19303004|PMID:19337156|PMID:21462384|PMID:21617751|PMID:21744490|PMID:23884333|PMID:24406863|PMID:24940934|PMID:25284770|PMID:25525159|PMID:25741868|PMID:25932442|PMID:26748743|PMID:26961680|PMID:28492532|PMID:9497262 Tgfbi Rat epithelial basement membrane dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Epithelial basement membrane dystrophy ClinVar PMID:16652336|PMID:19337156|PMID:25525159|PMID:28492532 Tgfbi Rat epithelial-stromal TGFBI dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Epithelial-stromal TGFBI dystrophy | ClinVar Annotator: match by term: TGFBI-related more ... ClinVar PMID:10798644|PMID:11923233|PMID:23559853|PMID:25741868|PMID:28492532|PMID:9054935|PMID:9463327|PMID:9559741 Tgfbi Rat familial adenomatous polyposis 1 ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Familial adenomatous polyposis 1 ClinVar PMID:17963004|PMID:18487285|PMID:19279422|PMID:19409520|PMID:20685668|PMID:21643010|PMID:28492532 Tgfbi Rat genetic disease ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Tgfbi Rat granular corneal dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Granular corneal dystrophy ClinVar Tgfbi Rat granular corneal dystrophy 1 ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Groenouw corneal dystrophy type I ClinVar PMID:11923233|PMID:1264234|PMID:21135107|PMID:21264234|PMID:22355247|PMID:23559853|PMID:25741868|PMID:28492532|PMID:9054935|PMID:9727509 Tgfbi Rat granular corneal dystrophy 2 ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Avellino corneal dystrophy | ClinVar Annotator: match by term: Granular more ... ClinVar PMID:10798644|PMID:11923233|PMID:15059726|PMID:16606891|PMID:23559853|PMID:25741868|PMID:26197481|PMID:28492532|PMID:34097874|PMID:9054935|PMID:9780098|PMID:9930165 Tgfbi Rat Hereditary Neoplastic Syndromes ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome ClinVar PMID:17963004|PMID:18487285|PMID:19279422|PMID:19409520|PMID:20685668|PMID:21643010|PMID:28492532 Tgfbi Rat Lattice Corneal Dystrophy Type 1 ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Lattice corneal dystrophy Type I ClinVar PMID:10798644|PMID:11923233|PMID:1264234|PMID:15059726|PMID:21135107|PMID:21264234|PMID:22355247|PMID:23559853|PMID:25741868|PMID:26197481|PMID:28492532|PMID:34097874|PMID:9054935|PMID:9463327|PMID:9559741|PMID:9727509 Tgfbi Rat Lattice Corneal Dystrophy, Type IIIA ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Corneal dystrophy, lattice type 3A ClinVar PMID:10832717|PMID:11004271|PMID:11024425|PMID:11923233|PMID:12400061|PMID:1264234|PMID:15790870|PMID:16809844|PMID:19337156|PMID:21135107|PMID:21264234|PMID:21462384|PMID:22355247|PMID:23559853|PMID:23884333|PMID:25741868|PMID:26748743|PMID:28492532|PMID:9054935|PMID:9497262|PMID:9727509 Tgfbi Rat Neurodevelopmental Disorders ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Neurodevelopmental disorder ClinVar PMID:25741868 Tgfbi Rat Reis-Bucklers corneal dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: GRANULAR CORNEAL DYSTROPHY, TYPE III | ClinVar Annotator: match by more ... ClinVar PMID:10660331|PMID:10798644|PMID:11146721|PMID:11923233|PMID:15885785|PMID:16606891|PMID:23559853|PMID:25741868|PMID:28492532|PMID:9780098|PMID:9930165 Tgfbi Rat Thiel-Behnke corneal dystrophy ISO RGD:1351420 8554872 ClinVar Annotator: match by term: Thiel-Behnke corneal dystrophy ClinVar PMID:11923233|PMID:21135107|PMID:22355247|PMID:25741868|PMID:28492532|PMID:9054935|PMID:9780098
Only show annotations with direct experimental evidence (0 objects hidden)
Tgfbi Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1351420 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TGFBI mRNA CTD PMID:22079256 Tgfbi Rat 1,1-dichloroethene increases expression ISO RGD:1553285 6480464 vinylidene chloride results in increased expression of TGFBI mRNA CTD PMID:26682919 Tgfbi Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1553285 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TGFBI mRNA CTD PMID:22206623 Tgfbi Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1553285 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TGFBI mRNA CTD PMID:17942748 Tgfbi Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of TGFBI mRNA CTD PMID:16174780 Tgfbi Rat 17beta-estradiol multiple interactions ISO RGD:1351420 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of TGFBI mRNA; [Estradiol co-treated with TGFB1 more ... CTD PMID:19619570|PMID:30165855 Tgfbi Rat 17beta-estradiol increases expression ISO RGD:1553285 6480464 Estradiol results in increased expression of TGFBI mRNA CTD PMID:39298647 Tgfbi Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TGFBI mRNA CTD PMID:32145629 Tgfbi Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFBI mRNA CTD PMID:32741896 Tgfbi Rat 17beta-estradiol increases expression ISO RGD:1351420 6480464 Estradiol results in increased expression of TGFBI mRNA CTD PMID:19619570 Tgfbi Rat 17beta-estradiol decreases expression ISO RGD:1553285 6480464 Estradiol results in decreased expression of TGFBI mRNA CTD PMID:15289156 Tgfbi Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFBI mRNA CTD PMID:32741896 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1351420 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of TGFBI mRNA CTD PMID:19619570 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TGFBI mRNA CTD PMID:34747641 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1553285 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFBI mRNA CTD PMID:33956508 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1351420 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFBI mRNA CTD PMID:19619570|PMID:20106945|PMID:21632981|PMID:22262711 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TGFBI mRNA CTD PMID:21215274 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFBI mRNA CTD PMID:15644576|PMID:33387578 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1553285 6480464 Tetrachlorodibenzodioxin results in increased expression of TGFBI mRNA CTD PMID:19933214 Tgfbi Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1553285 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TGFBI mRNA CTD PMID:17942748 Tgfbi Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1553285 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of TGFBI mRNA CTD PMID:38648751 Tgfbi Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of TGFBI mRNA CTD PMID:21346803 Tgfbi Rat 2-butoxyethanol decreases expression ISO RGD:1553285 6480464 n-butoxyethanol results in decreased expression of TGFBI mRNA CTD PMID:19812364 Tgfbi Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:1351420 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of TGFBI mRNA CTD PMID:22262711 Tgfbi Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1553285 6480464 tetrabromobisphenol A results in decreased expression of TGFBI mRNA CTD PMID:25172293 Tgfbi Rat 3,4-dichloroaniline decreases expression EXP 6480464 3,4-dichloroaniline results in decreased expression of TGFBI mRNA CTD PMID:24172598 Tgfbi Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1553285 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of TGFBI mRNA CTD PMID:30951980 Tgfbi Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1351420 6480464 bisphenol S results in increased expression of TGFBI protein CTD PMID:34186270 Tgfbi Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1553285 6480464 bisphenol S results in increased expression of TGFBI mRNA CTD PMID:30951980 Tgfbi Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1553285 6480464 Fenretinide results in decreased expression of TGFBI mRNA CTD PMID:28973697 Tgfbi Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat 4-tert-Octylphenol decreases expression EXP 6480464 4-tert-octylphenol results in decreased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:1351420 6480464 Decitabine results in increased expression of TGFBI mRNA CTD PMID:21856257 Tgfbi Rat 5-fluorouracil affects response to substance ISO RGD:1351420 6480464 TGFBI protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Tgfbi Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TGFBI mRNA CTD PMID:24780913|PMID:25825206|PMID:30047161 Tgfbi Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of TGFBI mRNA CTD PMID:28959563 Tgfbi Rat aflatoxin B1 increases expression ISO RGD:1553285 6480464 Aflatoxin B1 results in increased expression of TGFBI mRNA CTD PMID:19770486 Tgfbi Rat all-trans-retinoic acid decreases expression ISO RGD:1351420 6480464 Tretinoin results in decreased expression of TGFBI mRNA CTD PMID:21934132 Tgfbi Rat all-trans-retinoic acid multiple interactions ISO RGD:1553285 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFBI mRNA; [bisphenol F co-treated more ... CTD PMID:30951980 Tgfbi Rat all-trans-retinoic acid increases expression ISO RGD:1351420 6480464 Tretinoin results in increased expression of TGFBI mRNA CTD PMID:16951191|PMID:23830798 Tgfbi Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TGFBI mRNA CTD PMID:35163327 Tgfbi Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TGFBI mRNA CTD PMID:30047161 Tgfbi Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of TGFBI mRNA CTD PMID:30779732 Tgfbi Rat aristolochic acid A decreases expression ISO RGD:1351420 6480464 aristolochic acid I results in decreased expression of TGFBI mRNA CTD PMID:33212167 Tgfbi Rat arsane affects methylation ISO RGD:1351420 6480464 Arsenic affects the methylation of TGFBI gene CTD PMID:25304211 Tgfbi Rat arsane multiple interactions ISO RGD:1351420 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TGFBI more ... CTD PMID:39836092 Tgfbi Rat arsenic atom affects methylation ISO RGD:1351420 6480464 Arsenic affects the methylation of TGFBI gene CTD PMID:25304211 Tgfbi Rat arsenic atom multiple interactions ISO RGD:1351420 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TGFBI more ... CTD PMID:39836092 Tgfbi Rat arsenite(3-) decreases methylation ISO RGD:1351420 6480464 arsenite results in decreased methylation of TGFBI promoter CTD PMID:23974009 Tgfbi Rat asbestos decreases expression ISO RGD:1351420 6480464 Asbestos results in decreased expression of TGFBI mRNA CTD PMID:16920672 Tgfbi Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Tgfbi Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat benzo[a]pyrene increases methylation ISO RGD:1351420 6480464 Benzo(a)pyrene results in increased methylation of TGFBI promoter CTD PMID:27901495 Tgfbi Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1351420 6480464 Diethylhexyl Phthalate results in decreased expression of TGFBI protein CTD PMID:31163220 Tgfbi Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1351420 6480464 Diethylhexyl Phthalate results in increased expression of TGFBI mRNA CTD PMID:31163220 Tgfbi Rat bisphenol A affects expression ISO RGD:1553285 6480464 bisphenol A affects the expression of TGFBI mRNA CTD PMID:26063408 Tgfbi Rat bisphenol A affects expression ISO RGD:1351420 6480464 bisphenol A affects the expression of TGFBI mRNA CTD PMID:30903817 Tgfbi Rat bisphenol A multiple interactions ISO RGD:1553285 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of TGFBI mRNA CTD PMID:30951980 Tgfbi Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TGFBI gene CTD PMID:28505145 Tgfbi Rat bisphenol A increases expression ISO RGD:1553285 6480464 bisphenol A results in increased expression of TGFBI mRNA CTD PMID:27312807|PMID:30951980|PMID:38701888 Tgfbi Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TGFBI mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Tgfbi Rat bisphenol AF increases expression ISO RGD:1351420 6480464 bisphenol AF results in increased expression of TGFBI protein CTD PMID:34186270 Tgfbi Rat Bisphenol B increases expression ISO RGD:1351420 6480464 bisphenol B results in increased expression of TGFBI protein CTD PMID:34186270 Tgfbi Rat bisphenol F increases expression ISO RGD:1553285 6480464 bisphenol F results in increased expression of TGFBI mRNA CTD PMID:30951980|PMID:38685157 Tgfbi Rat bisphenol F increases expression ISO RGD:1351420 6480464 bisphenol F results in increased expression of TGFBI protein CTD PMID:34186270 Tgfbi Rat bisphenol F multiple interactions ISO RGD:1553285 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TGFBI mRNA CTD PMID:30951980 Tgfbi Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TGFBI mRNA CTD PMID:19167457 Tgfbi Rat cadmium atom multiple interactions ISO RGD:1351420 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TGFBI more ... CTD PMID:29741670|PMID:31738976 Tgfbi Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of TGFBI promoter CTD PMID:22457795 Tgfbi Rat cadmium dichloride multiple interactions ISO RGD:1351420 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TGFBI more ... CTD PMID:29741670|PMID:31738976 Tgfbi Rat carbamazepine affects expression ISO RGD:1351420 6480464 Carbamazepine affects the expression of TGFBI mRNA CTD PMID:25979313 Tgfbi Rat carbon nanotube increases expression ISO RGD:1553285 6480464 Nanotubes, Carbon analog results in increased expression of TGFBI mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Tgfbi Rat chloropicrin decreases expression ISO RGD:1351420 6480464 chloropicrin results in decreased expression of TGFBI mRNA CTD PMID:26352163 Tgfbi Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Tgfbi Rat choline multiple interactions ISO RGD:1553285 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Tgfbi Rat chromium(6+) affects expression ISO RGD:1553285 6480464 chromium hexavalent ion affects the expression of TGFBI mRNA CTD PMID:28472532 Tgfbi Rat chromium(6+) multiple interactions ISO RGD:1351420 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:38479592 Tgfbi Rat chromium(6+) affects expression ISO RGD:1351420 6480464 chromium hexavalent ion affects the expression of TGFBI mRNA CTD PMID:30690063 Tgfbi Rat cisplatin decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Cisplatin CTD PMID:25199881 Tgfbi Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TGFBI mRNA CTD PMID:17602206 Tgfbi Rat clothianidin increases expression ISO RGD:1351420 6480464 clothianidin results in increased expression of TGFBI mRNA CTD PMID:31626844 Tgfbi Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of TGFBI mRNA CTD PMID:30047161 Tgfbi Rat cobalt dichloride decreases secretion ISO RGD:1351420 6480464 cobaltous chloride results in decreased secretion of TGFBI protein CTD PMID:22079246 Tgfbi Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TGFBI mRNA CTD PMID:24386269 Tgfbi Rat copper(II) sulfate decreases expression ISO RGD:1351420 6480464 Copper Sulfate results in decreased expression of TGFBI mRNA CTD PMID:19549813 Tgfbi Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TGFBI mRNA CTD PMID:26577399 Tgfbi Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TGFBI mRNA CTD PMID:27523638 Tgfbi Rat cyclosporin A decreases expression ISO RGD:1351420 6480464 Cyclosporine results in decreased expression of TGFBI mRNA CTD PMID:27989131 Tgfbi Rat dabrafenib multiple interactions ISO RGD:1351420 6480464 dabrafenib inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased expression of TGFBI more ... CTD PMID:29042256 Tgfbi Rat dexamethasone decreases expression ISO RGD:1351420 6480464 Dexamethasone results in decreased expression of TGFBI mRNA CTD PMID:25047013 Tgfbi Rat Dibutyl phosphate affects expression ISO RGD:1351420 6480464 di-n-butylphosphoric acid affects the expression of TGFBI mRNA CTD PMID:37042841 Tgfbi Rat dicyclanil decreases expression ISO RGD:1553285 6480464 dicyclanil results in decreased expression of TGFBI mRNA CTD PMID:15664270 Tgfbi Rat diethylstilbestrol decreases expression ISO RGD:1553285 6480464 Diethylstilbestrol results in decreased expression of TGFBI mRNA CTD PMID:15289156 Tgfbi Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of TGFBI mRNA CTD PMID:37567419 Tgfbi Rat dioxygen increases expression ISO RGD:1351420 6480464 Oxygen deficiency results in increased expression of TGFBI mRNA CTD PMID:26516004 Tgfbi Rat dioxygen multiple interactions ISO RGD:1553285 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TGFBI mRNA CTD PMID:30529165 Tgfbi Rat diquat decreases expression ISO RGD:1553285 6480464 Diquat results in decreased expression of TGFBI mRNA CTD PMID:36851058 Tgfbi Rat diuron increases expression EXP 6480464 Diuron results in increased expression of TGFBI mRNA CTD PMID:21551480 Tgfbi Rat diuron decreases expression EXP 6480464 Diuron metabolite results in decreased expression of TGFBI mRNA CTD PMID:24172598 Tgfbi Rat dorsomorphin multiple interactions ISO RGD:1351420 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Tgfbi Rat doxorubicin decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Doxorubicin CTD PMID:25199881 Tgfbi Rat doxorubicin increases expression ISO RGD:1351420 6480464 Doxorubicin results in increased expression of TGFBI mRNA CTD PMID:30031762 Tgfbi Rat doxorubicin affects expression ISO RGD:1351420 6480464 Doxorubicin affects the expression of TGFBI mRNA; Doxorubicin affects the expression of TGFBI protein CTD PMID:29385562|PMID:29803840 Tgfbi Rat enalapril decreases secretion EXP 6480464 Enalapril results in decreased secretion of TGFBI protein CTD PMID:18682491 Tgfbi Rat enalapril multiple interactions EXP 6480464 [eplerenone co-treated with Enalapril] results in decreased secretion of TGFBI protein CTD PMID:18682491 Tgfbi Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TGFBI mRNA CTD PMID:29391264 Tgfbi Rat eplerenone multiple interactions EXP 6480464 [eplerenone co-treated with Enalapril] results in decreased secretion of TGFBI protein CTD PMID:18682491 Tgfbi Rat eplerenone decreases secretion EXP 6480464 eplerenone results in decreased secretion of TGFBI protein CTD PMID:18682491 Tgfbi Rat epoxiconazole decreases expression ISO RGD:1553285 6480464 epoxiconazole results in decreased expression of TGFBI mRNA CTD PMID:35436446 Tgfbi Rat ferric oxide increases expression ISO RGD:1553285 6480464 ferric oxide analog results in increased expression of TGFBI mRNA CTD PMID:24525745 Tgfbi Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TGFBI mRNA CTD PMID:24136188 Tgfbi Rat folic acid multiple interactions ISO RGD:1553285 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TGFBI mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Tgfbi Rat genistein decreases expression ISO RGD:1553285 6480464 Genistein results in decreased expression of TGFBI mRNA CTD PMID:15289156 Tgfbi Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of TGFBI mRNA CTD PMID:24915197 Tgfbi Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of TGFBI mRNA CTD PMID:24395379 Tgfbi Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Tgfbi Rat graphene oxide increases expression ISO RGD:1351420 6480464 graphene oxide results in increased expression of TGFBI protein CTD PMID:33219560|PMID:33219582 Tgfbi Rat GW 4064 increases expression ISO RGD:1553285 6480464 GW 4064 results in increased expression of TGFBI mRNA CTD PMID:26655953 Tgfbi Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Tgfbi Rat inulin multiple interactions ISO RGD:1553285 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TGFBI mRNA CTD PMID:36331819 Tgfbi Rat irinotecan decreases expression ISO RGD:1351420 6480464 Irinotecan analog results in decreased expression of TGFBI mRNA CTD PMID:18927307 Tgfbi Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat L-methionine multiple interactions ISO RGD:1553285 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Tgfbi Rat lead diacetate increases expression ISO RGD:1351420 6480464 lead acetate results in increased expression of TGFBI mRNA CTD PMID:38568856 Tgfbi Rat lead(0) decreases expression ISO RGD:1351420 6480464 Lead results in decreased expression of TGFBI mRNA CTD PMID:19921347 Tgfbi Rat lipopolysaccharide affects expression ISO RGD:1351420 6480464 Lipopolysaccharides affects the expression of TGFBI mRNA CTD PMID:28070326 Tgfbi Rat lipopolysaccharide increases secretion ISO RGD:1351420 6480464 Lipopolysaccharides results in increased secretion of TGFBI protein CTD PMID:26084452|PMID:27887929 Tgfbi Rat lipopolysaccharide increases expression ISO RGD:1351420 6480464 Lipopolysaccharides results in increased expression of TGFBI mRNA CTD PMID:27887929 Tgfbi Rat lipopolysaccharide multiple interactions ISO RGD:1351420 6480464 apigenin-6,8-di-C-glycopyranoside inhibits the reaction [Lipopolysaccharides results in increased secretion of TGFBI protein]; Plant Extracts affects more ... CTD PMID:26084452|PMID:27887929|PMID:28070326 Tgfbi Rat lipopolysaccharide increases expression ISO RGD:1553285 6480464 Lipopolysaccharides results in increased expression of TGFBI mRNA CTD PMID:27339419 Tgfbi Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of TGFBI mRNA CTD PMID:30047161 Tgfbi Rat methotrexate decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Methotrexate CTD PMID:25199881 Tgfbi Rat mitomycin C decreases expression ISO RGD:1351420 6480464 Mitomycin results in decreased expression of TGFBI mRNA; Mitomycin results in decreased expression of TGFBI more ... CTD PMID:18615204 Tgfbi Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO RGD:1553285 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of TGFBI mRNA CTD PMID:25566086 Tgfbi Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TGFBI mRNA CTD PMID:17602206 Tgfbi Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of TGFBI mRNA CTD PMID:19638242 Tgfbi Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of TGFBI mRNA CTD PMID:24136188 Tgfbi Rat nickel atom increases expression ISO RGD:1553285 6480464 Nickel results in increased expression of TGFBI mRNA CTD PMID:12540486 Tgfbi Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of TGFBI mRNA CTD PMID:24136188 Tgfbi Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of TGFBI mRNA CTD PMID:25729387 Tgfbi Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TGFBI mRNA CTD PMID:25729387 Tgfbi Rat ozone multiple interactions ISO RGD:1553285 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Tgfbi Rat ozone multiple interactions ISO RGD:1351420 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TGFBI mRNA CTD PMID:35430440 Tgfbi Rat p-tert-Amylphenol decreases expression EXP 6480464 4-tert-octylphenol results in decreased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of TGFBI mRNA CTD PMID:17011747 Tgfbi Rat paclitaxel decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Paclitaxel CTD PMID:25199881 Tgfbi Rat panobinostat multiple interactions ISO RGD:1351420 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Tgfbi Rat paracetamol affects expression ISO RGD:1553285 6480464 Acetaminophen affects the expression of TGFBI mRNA CTD PMID:17562736 Tgfbi Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TGFBI mRNA CTD PMID:33387578 Tgfbi Rat paracetamol affects expression ISO RGD:1351420 6480464 Acetaminophen affects the expression of TGFBI mRNA CTD PMID:25458485 Tgfbi Rat paracetamol decreases expression ISO RGD:1351420 6480464 Acetaminophen results in decreased expression of TGFBI mRNA CTD PMID:21420995 Tgfbi Rat pentane-2,3-dione increases expression EXP 6480464 2,3-pentanedione results in increased expression of TGFBI mRNA CTD PMID:25710175 Tgfbi Rat perfluorohexanesulfonic acid increases expression ISO RGD:1553285 6480464 perfluorohexanesulfonic acid results in increased expression of TGFBI mRNA CTD PMID:37995155 Tgfbi Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of TGFBI mRNA CTD PMID:18692542 Tgfbi Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1553285 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TGFBI mRNA CTD PMID:36331819 Tgfbi Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of TGFBI mRNA CTD PMID:35163327 Tgfbi Rat phenobarbital multiple interactions ISO RGD:1553285 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of TGFBI mRNA] CTD PMID:19482888 Tgfbi Rat phenobarbital decreases expression ISO RGD:1553285 6480464 Phenobarbital results in decreased expression of TGFBI mRNA CTD PMID:19482888 Tgfbi Rat phenylmercury acetate decreases expression ISO RGD:1351420 6480464 Phenylmercuric Acetate results in decreased expression of TGFBI mRNA CTD PMID:26272509 Tgfbi Rat phenylmercury acetate multiple interactions ISO RGD:1351420 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Tgfbi Rat pirinixic acid decreases expression ISO RGD:1553285 6480464 pirinixic acid results in decreased expression of TGFBI mRNA CTD PMID:17426115 Tgfbi Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat potassium chromate multiple interactions ISO RGD:1351420 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of TGFBI mRNA CTD PMID:22079256 Tgfbi Rat potassium chromate decreases expression ISO RGD:1351420 6480464 potassium chromate(VI) results in decreased expression of TGFBI mRNA CTD PMID:22714537 Tgfbi Rat potassium chromate increases expression ISO RGD:1351420 6480464 potassium chromate(VI) results in increased expression of TGFBI mRNA CTD PMID:22079256 Tgfbi Rat potassium dichromate decreases expression ISO RGD:1351420 6480464 Potassium Dichromate results in decreased expression of TGFBI protein CTD PMID:23718831 Tgfbi Rat raloxifene affects expression ISO RGD:1351420 6480464 Raloxifene Hydrochloride affects the expression of TGFBI mRNA CTD PMID:14699072 Tgfbi Rat raloxifene multiple interactions ISO RGD:1351420 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in decreased expression of TGFBI mRNA; [Raloxifene Hydrochloride more ... CTD PMID:19059307 Tgfbi Rat resveratrol decreases expression ISO RGD:1351420 6480464 resveratrol results in decreased expression of TGFBI mRNA CTD PMID:25888808 Tgfbi Rat SB 431542 multiple interactions ISO RGD:1351420 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Tgfbi Rat silicon dioxide decreases secretion ISO RGD:1351420 6480464 Silicon Dioxide analog results in decreased secretion of TGFBI protein CTD PMID:25895662 Tgfbi Rat silicon dioxide decreases expression ISO RGD:1553285 6480464 Silicon Dioxide results in decreased expression of TGFBI mRNA CTD PMID:29203145 Tgfbi Rat sodium arsenite multiple interactions ISO RGD:1351420 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TGFBI more ... CTD PMID:39836092 Tgfbi Rat sodium dichromate decreases expression ISO RGD:1351420 6480464 sodium bichromate results in decreased expression of TGFBI mRNA CTD PMID:17685462 Tgfbi Rat Soman increases expression EXP 6480464 Soman results in increased expression of TGFBI mRNA CTD PMID:19281266 Tgfbi Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of TGFBI mRNA CTD PMID:30047161 Tgfbi Rat sunitinib decreases expression ISO RGD:1351420 6480464 Sunitinib results in decreased expression of TGFBI mRNA CTD PMID:31533062 Tgfbi Rat tacrolimus hydrate increases expression ISO RGD:1553285 6480464 Tacrolimus results in increased expression of TGFBI mRNA CTD PMID:29362864 Tgfbi Rat tamoxifen multiple interactions ISO RGD:1351420 6480464 [Tamoxifen co-treated with ESR1 protein] results in decreased expression of TGFBI mRNA; [Tamoxifen co-treated with more ... CTD PMID:19059307 Tgfbi Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of TGFBI mRNA CTD PMID:15885361 Tgfbi Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TGFBI mRNA CTD PMID:32741896 Tgfbi Rat tetrachloromethane affects expression ISO RGD:1553285 6480464 Carbon Tetrachloride affects the expression of TGFBI mRNA CTD PMID:17484886 Tgfbi Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TGFBI mRNA CTD PMID:31150632 Tgfbi Rat tetrachloromethane increases expression ISO RGD:1553285 6480464 Carbon Tetrachloride results in increased expression of TGFBI mRNA CTD PMID:27339419|PMID:31919559 Tgfbi Rat thalidomide decreases expression ISO RGD:1553285 6480464 Thalidomide results in decreased expression of TGFBI mRNA CTD PMID:26006729|PMID:26217789 Tgfbi Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Tgfbi Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of TGFBI mRNA CTD PMID:19483382 Tgfbi Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TGFBI mRNA CTD PMID:34492290 Tgfbi Rat thiram increases expression ISO RGD:1351420 6480464 Thiram results in increased expression of TGFBI mRNA CTD PMID:38568856 Tgfbi Rat titanium dioxide increases expression ISO RGD:1553285 6480464 titanium dioxide results in increased expression of TGFBI mRNA CTD PMID:23557971|PMID:27760801 Tgfbi Rat titanium dioxide increases methylation ISO RGD:1553285 6480464 titanium dioxide results in increased methylation of TGFBI promoter CTD PMID:35295148 Tgfbi Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of TGFBI mRNA CTD PMID:25729387 Tgfbi Rat topotecan decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Topotecan CTD PMID:25199881 Tgfbi Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TGFBI mRNA CTD PMID:25729387 Tgfbi Rat tremolite asbestos increases expression ISO RGD:1553285 6480464 tremolite results in increased expression of TGFBI mRNA CTD PMID:29279043 Tgfbi Rat trichostatin A decreases expression ISO RGD:1351420 6480464 trichostatin A results in decreased expression of TGFBI mRNA CTD PMID:24935251 Tgfbi Rat triclosan increases expression ISO RGD:1351420 6480464 Triclosan results in increased expression of TGFBI mRNA CTD PMID:30510588 Tgfbi Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of TGFBI mRNA CTD PMID:15885361 Tgfbi Rat valproic acid decreases expression ISO RGD:1351420 6480464 Valproic Acid results in decreased expression of TGFBI mRNA CTD PMID:24935251 Tgfbi Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of TGFBI mRNA CTD PMID:29427782 Tgfbi Rat valproic acid increases expression ISO RGD:1553285 6480464 Valproic Acid results in increased expression of TGFBI mRNA CTD PMID:24896083 Tgfbi Rat vincristine decreases response to substance ISO RGD:1351420 6480464 TGFBI mRNA results in decreased susceptibility to Vincristine CTD PMID:25199881 Tgfbi Rat vitamin E increases expression ISO RGD:1351420 6480464 Vitamin E results in increased expression of TGFBI mRNA CTD PMID:19244175
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-dichloroaniline (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-tert-Octylphenol (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amiodarone (EXP) amitrole (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) asbestos (ISO) azoxystrobin (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (EXP) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP) clofibric acid (EXP) clothianidin (ISO) clotrimazole (EXP) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dabrafenib (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicyclanil (ISO) diethylstilbestrol (EXP,ISO) dimethylarsinic acid (EXP) dioxygen (ISO) diquat (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enalapril (EXP) endosulfan (EXP) eplerenone (EXP) epoxiconazole (ISO) ferric oxide (ISO) flutamide (EXP) folic acid (ISO) genistein (ISO) glycidol (EXP) glyphosate (EXP) graphene oxide (ISO) GW 4064 (ISO) imidacloprid (EXP) inulin (ISO) irinotecan (ISO) L-ethionine (EXP) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) methimazole (EXP) methotrexate (ISO) mitomycin C (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) omeprazole (EXP) oxaliplatin (EXP) ozone (ISO) p-tert-Amylphenol (EXP) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) pentane-2,3-dione (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) potassium dichromate (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) tauroursodeoxycholic acid (EXP) testosterone (EXP) tetrachloromethane (EXP,ISO) thalidomide (ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP,ISO) tremolite asbestos (ISO) trichostatin A (ISO) triclosan (ISO) ursodeoxycholic acid (EXP) valproic acid (EXP,ISO) vincristine (ISO) vitamin E (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Expression of TGF-beta-induced matrix protein betaig-h3 is up-regulated in the diabetic rat kidney and human proximal tubular epithelial cells treated with high glucose.
Lee SH, etal., Kidney Int 2003 Sep;64(3):1012-21.
4.
Inhibitory effect of pravastatin on transforming growth factor beta1-inducible gene h3 expression in a rat model of chronic cyclosporine nephropathy.
Li C, etal., Am J Nephrol. 2005 Nov-Dec;25(6):611-20. Epub 2005 Nov 22.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Kerato-epithelin mutations in four 5q31-linked corneal dystrophies.
Munier FL, etal., Nat Genet. 1997 Mar;15(3):247-51.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Mechanical regulation of terminal chondrocyte differentiation via RGD-CAP/beta ig-h3 induced by TGF-beta.
Ohno S, etal., Connect Tissue Res. 2005;46(4-5):227-34.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Expression of transforming growth factor-beta-inducible gene-h3 in normal and cyclosporine-treated rat kidney.
Sun BK, etal., J Lab Clin Med 2004 Mar;143(3):175-83.
Tgfbi Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 7,960,885 - 7,990,234 (-) NCBI GRCr8 mRatBN7.2 17 7,955,603 - 7,984,903 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 7,955,603 - 7,985,240 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 7,973,969 - 8,002,492 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 9,505,209 - 9,534,325 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 7,970,355 - 7,998,883 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 8,400,123 - 8,429,338 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 8,400,146 - 8,429,338 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 10,576,347 - 10,605,606 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 13,904,882 - 13,935,110 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 13,907,546 - 13,912,997 (-) NCBI Celera 17 8,049,686 - 8,078,886 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
TGFBI Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 136,028,988 - 136,063,818 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 136,028,988 - 136,063,818 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 135,364,677 - 135,399,507 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 135,392,597 - 135,427,406 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 135,392,596 - 135,427,406 NCBI Celera 5 131,489,316 - 131,524,237 (+) NCBI Celera Cytogenetic Map 5 q31.1 NCBI HuRef 5 130,553,034 - 130,587,955 (+) NCBI HuRef CHM1_1 5 134,797,217 - 134,832,140 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 136,551,486 - 136,586,315 (+) NCBI T2T-CHM13v2.0
Tgfbi Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 56,757,399 - 56,787,172 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 56,757,336 - 56,787,375 (+) Ensembl GRCm39 Ensembl GRCm38 13 56,609,586 - 56,639,359 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 56,609,523 - 56,639,562 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 56,710,964 - 56,740,700 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 56,619,225 - 56,648,961 (+) NCBI MGSCv36 mm8 Celera 13 57,674,398 - 57,704,061 (+) NCBI Celera Cytogenetic Map 13 B1 NCBI cM Map 13 30.09 NCBI
Tgfbi Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 31,093,050 - 31,125,398 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 31,093,450 - 31,124,715 (+) NCBI ChiLan1.0 ChiLan1.0
TGFBI Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 131,295,568 - 131,350,946 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 129,405,032 - 129,490,506 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 131,420,403 - 131,455,265 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 137,560,046 - 137,594,970 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 137,559,321 - 137,596,392 (+) Ensembl panpan1.1 panPan2
TGFBI Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 23,932,038 - 23,971,983 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 23,938,453 - 23,971,607 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 22,686,607 - 22,719,238 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 24,755,795 - 24,788,452 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 24,755,189 - 24,788,074 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 23,442,552 - 23,475,191 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 23,309,379 - 23,341,990 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 23,958,407 - 23,991,029 (+) NCBI UU_Cfam_GSD_1.0
Tgfbi Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 124,103,129 - 124,136,978 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936597 3,127,795 - 3,162,242 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936597 3,128,007 - 3,161,885 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TGFBI Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 138,191,807 - 138,225,366 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 138,191,793 - 138,225,373 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 143,856,237 - 143,880,047 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TGFBI Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 38,774,387 - 38,808,624 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 38,774,473 - 38,808,649 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 39,100,477 - 39,134,819 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tgfbi
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 82 Interacting mature miRNAs: 103 Transcripts: ENSRNOT00000016390 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 4299130 21293263 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 1581553 Pur14 Proteinuria QTL 14 5.3 0.0001 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 17 7979968 16317111 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2115149 21881669 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22871563 Rat
D17Rat76
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 7,985,243 - 7,985,461 (+) Marker Load Pipeline mRatBN7.2 17 7,979,968 - 7,980,186 (+) MAPPER mRatBN7.2 Rnor_6.0 17 8,424,467 - 8,424,684 NCBI Rnor6.0 Rnor_5.0 17 10,600,735 - 10,600,952 UniSTS Rnor5.0 RGSC_v3.4 17 13,930,241 - 13,930,458 UniSTS RGSC3.4 RGSC_v3.4 17 13,930,240 - 13,930,458 RGD RGSC3.4 RGSC_v3.1 17 13,930,241 - 13,930,458 RGD Celera 17 8,074,017 - 8,074,234 UniSTS RH 3.4 Map 17 74.0 RGD RH 3.4 Map 17 74.0 UniSTS RH 2.0 Map 17 48.0 RGD SHRSP x BN Map 17 6.81 RGD FHH x ACI Map 17 4.4999 RGD Cytogenetic Map 17 p14 UniSTS
D17Wox2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 7,984,899 - 7,985,004 (+) Marker Load Pipeline mRatBN7.2 17 7,979,624 - 7,979,729 (+) MAPPER mRatBN7.2 Rnor_6.0 17 8,424,123 - 8,424,227 NCBI Rnor6.0 Rnor_5.0 17 10,600,391 - 10,600,495 UniSTS Rnor5.0 RGSC_v3.4 17 13,929,896 - 13,930,001 RGD RGSC3.4 RGSC_v3.4 17 13,929,897 - 13,930,001 UniSTS RGSC3.4 RGSC_v3.1 17 13,929,896 - 13,930,001 RGD Celera 17 8,073,673 - 8,073,777 UniSTS RH 3.4 Map 17 75.3 RGD RH 3.4 Map 17 75.3 UniSTS RH 2.0 Map 17 48.1 RGD Cytogenetic Map 17 p14 UniSTS
RH127317
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 7,955,659 - 7,955,869 (+) MAPPER mRatBN7.2 Rnor_6.0 17 8,400,180 - 8,400,389 NCBI Rnor6.0 Rnor_5.0 17 10,576,404 - 10,576,613 UniSTS Rnor5.0 RGSC_v3.4 17 13,904,939 - 13,905,148 UniSTS RGSC3.4 Celera 17 8,049,743 - 8,049,952 UniSTS RH 3.4 Map 17 74.6 UniSTS Cytogenetic Map 17 p14 UniSTS
RH129409
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 7,955,616 - 7,955,826 (+) MAPPER mRatBN7.2 Rnor_6.0 17 8,400,137 - 8,400,346 NCBI Rnor6.0 Rnor_5.0 17 10,576,361 - 10,576,570 UniSTS Rnor5.0 RGSC_v3.4 17 13,904,896 - 13,905,105 UniSTS RGSC3.4 Celera 17 8,049,700 - 8,049,909 UniSTS RH 3.4 Map 17 73.6 UniSTS Cytogenetic Map 17 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016390 ⟹ ENSRNOP00000016389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 7,955,604 - 7,984,873 (-) Ensembl Rnor_6.0 Ensembl 17 8,400,146 - 8,429,338 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108364 ⟹ ENSRNOP00000081900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 7,955,603 - 7,982,048 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112669 ⟹ ENSRNOP00000094843
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 7,955,603 - 7,985,240 (-) Ensembl
RefSeq Acc Id:
NM_053802 ⟹ NP_446254
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 7,960,885 - 7,990,113 (-) NCBI mRatBN7.2 17 7,955,603 - 7,984,838 (-) NCBI Rnor_6.0 17 8,400,123 - 8,429,338 (-) NCBI Rnor_5.0 17 10,576,347 - 10,605,606 (-) NCBI RGSC_v3.4 17 13,904,882 - 13,935,110 (-) RGD Celera 17 8,049,686 - 8,078,886 (-) RGD
Sequence:
CGTGGGTCCGCGCGTGCTTCAGCTCCATGGCGCTCCTCGTGCGGCTGCTGCCCCTCGCTCTGGCTCTGTCTCTGGGCTTCACCGGGACCCTGGCGGGCCCGGCCAAGTCACCCTATCAGCTGGTGCTG
hide sequence
RefSeq Acc Id:
XM_039095289 ⟹ XP_038951217
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 7,960,885 - 7,990,234 (-) NCBI mRatBN7.2 17 7,955,603 - 7,984,903 (-) NCBI
RefSeq Acc Id:
NP_446254 ⟸ NM_053802
- Peptide Label:
precursor
- UniProtKB:
D4A8G5 (UniProtKB/TrEMBL)
- Sequence:
MALLVRLLPLALALSLGFTGTLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNKKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGIVGSTTTQLYTDRTEKL
hide sequence
Ensembl Acc Id:
ENSRNOP00000016389 ⟸ ENSRNOT00000016390
RefSeq Acc Id:
XP_038951217 ⟸ XM_039095289
- Peptide Label:
isoform X1
- UniProtKB:
D4A8G5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094843 ⟸ ENSRNOT00000112669
Ensembl Acc Id:
ENSRNOP00000081900 ⟸ ENSRNOT00000108364
RGD ID: 13700286 Promoter ID: EPDNEW_R10809 Type: initiation region Name: Tgfbi_1 Description: transforming growth factor, beta induced SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 8,429,373 - 8,429,433 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Tgfbi
transforming growth factor, beta induced
transforming growth factor, beta induced, 68 kDa
Name updated
1299863 APPROVED
2002-08-07
Tgfbi
transforming growth factor, beta induced, 68 kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
