Nsfl1c (NSFL1 cofactor) - Rat Genome Database

Name: Nsfl1c
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Nsfl1c (NSFL1 cofactor) Rattus norvegicus

Analyze

Symbol:

Nsfl1c

Name:

NSFL1 cofactor

RGD ID:

619952

Description:

Enables ATPase binding activity and ubiquitin binding activity. Contributes to phospholipid binding activity. Involved in Golgi organization and membrane fusion. Located in cytosol and spindle pole centrosome. Part of VCP-NSFL1C complex. Orthologous to human NSFL1C (NSFL1 cofactor); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,5-hexanedione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

NSFL1 (p97) cofactor (p47); NSFL1 cofactor p47; p47; p97 cofactor p47; XY body-associated protein XY40; XY40

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NSFL1C (NSFL1 cofactor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):	Nsfl1c (NSFL1 (p97) cofactor (p47))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nsfl1c (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NSFL1C (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NSFL1C (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nsfl1c (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NSFL1C (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NSFL1C (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nsfl1c (NSFL1 cofactor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FECH (ferrochelatase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NSFL1C (NSFL1 cofactor)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nsfl1c (NSFL1 (p97) cofactor (p47))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nsfl1c (NSFL1 (p97) cofactor (p47))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SHP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ubxn-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	p47	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,438,708 - 160,463,261 (+)	NCBI		GRCr8
mRatBN7.2	3	139,978,306 - 140,002,876 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,978,301 - 140,002,870 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,882,849 - 143,907,438 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,466,609 - 152,491,210 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,207,072 - 150,231,679 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,980,923 - 147,005,478 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,980,923 - 147,005,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,337,781 - 153,361,989 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,799,286 - 141,823,762 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,704,858 - 141,729,335 (+)	NCBI
Celera	3	138,737,682 - 138,762,227 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,5-hexanedione (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

caffeine (ISO)

chrysene (ISO)

clotrimazole (EXP)

cobalt dichloride (EXP,ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

cyproconazole (ISO)

dibutyl phthalate (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (EXP,ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

hydralazine (ISO)

ivermectin (ISO)

lithium atom (EXP)

lithium hydride (EXP)

methapyrilene (EXP)

methidathion (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel sulfate (ISO)

Nutlin-3 (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

propiconazole (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulfasalazine (EXP)

T-2 toxin (EXP)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome assembly (IBA)

establishment of mitotic spindle orientation (ISO)

Golgi organization (IBA,IDA)

membrane fusion (IBA,IDA)

negative regulation of protein localization to centrosome (ISO)

nuclear membrane reassembly (IBA)

positive regulation of mitotic centrosome separation (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

Cellular Component

centrosome (IEA)

chromosome (IEA)

cytoplasm (IEA,NAS)

cytosol (IBA,IDA)

Golgi stack (IEA)

nucleus (IBA,IEA)

spindle pole centrosome (IDA)

VCP-NSFL1C complex (IEA,IPI,ISO)

Molecular Function

ATPase binding (IPI)

lipid binding (IEA)

phospholipid binding (IDA)

protein binding (IPI,ISO)

ubiquitin binding (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

Endoplasmic Reticulum-associated degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.	Alexandru G, etal., Cell. 2008 Sep 5;134(5):804-16. doi: 10.1016/j.cell.2008.06.048.
2.	Molecular characterization and expression pattern of XY body-associated protein XY40 of the rat.	Alsheimer M, etal., Chromosoma 1997 Oct;106(5):308-14.
3.	Conformational changes in the AAA ATPase p97-p47 adaptor complex.	Beuron F, etal., EMBO J. 2006 May 3;25(9):1967-76. Epub 2006 Apr 6.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Isolation of a point-mutated p47 lacking binding affinity to p97ATPase.	Kaneko Y, etal., FEBS Lett. 2010 Sep 24;584(18):3873-7. doi: 10.1016/j.febslet.2010.07.061. Epub 2010 Aug 6.
6.	p47 is a cofactor for p97-mediated membrane fusion.	Kondo H, etal., Nature 1997 Jul 3;388(6637):75-8.
7.	The UBXN-2/p37/p47 adaptors of CDC-48/p97 regulate mitosis by limiting the centrosomal recruitment of Aurora A.	Kress E, etal., J Cell Biol. 2013 May 13;201(4):559-75. doi: 10.1083/jcb.201209107. Epub 2013 May 6.
8.	A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways.	Meyer HH, etal., EMBO J 2000 May 15;19(10):2181-92.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Phospholipid species act as modulators in p97/p47-mediated fusion of Golgi membranes.	Pecheur EI, etal., Biochemistry 2002 Aug 6;41(31):9813-23.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains.	Ye Y, etal., J Cell Biol. 2003 Jul 7;162(1):71-84.

Additional References at PubMed

PMID:1495983	PMID:9506515	PMID:9824302	PMID:10930451	PMID:11478859	PMID:12411482	PMID:12473691	PMID:12810701	PMID:15489334	PMID:16396499	PMID:16641100	PMID:17601490
PMID:19182904	PMID:23295407	PMID:23429921

Genomics

Comparative Map Data

Nsfl1c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,438,708 - 160,463,261 (+)	NCBI		GRCr8
mRatBN7.2	3	139,978,306 - 140,002,876 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,978,301 - 140,002,870 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,882,849 - 143,907,438 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,466,609 - 152,491,210 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,207,072 - 150,231,679 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,980,923 - 147,005,478 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,980,923 - 147,005,439 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,337,781 - 153,361,989 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,799,286 - 141,823,762 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,704,858 - 141,729,335 (+)	NCBI
Celera	3	138,737,682 - 138,762,227 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

NSFL1C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	1,442,166 - 1,466,849 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	1,442,162 - 1,473,842 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	1,422,811 - 1,447,494 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	1,370,811 - 1,396,417 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	1,370,810 - 1,396,417	NCBI
Celera	20	1,519,162 - 1,544,783 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	1,373,688 - 1,399,218 (-)	NCBI		HuRef
CHM1_1	20	1,421,141 - 1,446,667 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	1,491,358 - 1,516,046 (-)	NCBI		T2T-CHM13v2.0

Nsfl1c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	151,336,102 - 151,353,230 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	151,336,102 - 151,353,334 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	151,494,182 - 151,511,310 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	151,494,182 - 151,511,414 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	151,320,044 - 151,337,041 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,185,749 - 151,202,746 (+)	NCBI		MGSCv36	mm8
Celera	2	157,311,678 - 157,328,675 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Nsfl1c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955596	648,978 - 673,585 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955596	648,978 - 673,586 (-)	NCBI	ChiLan1.0	ChiLan1.0

NSFL1C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	2,479,116 - 2,503,537 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	2,475,944 - 2,500,365 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	1,597,171 - 1,622,708 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	1,364,008 - 1,389,548 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	1,364,008 - 1,389,548 (-)	Ensembl	panpan1.1		panPan2

NSFL1C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	19,575,543 - 19,599,002 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	19,575,580 - 19,597,653 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	19,294,327 - 19,317,815 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	20,267,728 - 20,291,217 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	20,267,773 - 20,291,220 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	19,544,333 - 19,567,801 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	19,649,280 - 19,672,767 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,080,100 - 20,103,589 (+)	NCBI		UU_Cfam_GSD_1.0

Nsfl1c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	168,786,098 - 168,806,889 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	17,217,462 - 17,238,628 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	17,217,462 - 17,238,253 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NSFL1C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	33,869,527 - 33,892,064 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	33,869,487 - 33,890,873 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	38,513,369 - 38,535,943 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NSFL1C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	55,102,384 - 55,127,928 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	55,103,266 - 55,126,341 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666087	1,507,616 - 1,533,114 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nsfl1c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	2,748,796 - 2,774,119 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	2,746,853 - 2,774,038 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nsfl1c
135 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000011654
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

WI-20603

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	140,002,573 - 140,002,821 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	147,005,176 - 147,005,423	NCBI	Rnor6.0
Rnor_5.0	3	153,361,687 - 153,361,934	UniSTS	Rnor5.0
RGSC_v3.4	3	141,823,468 - 141,823,715	UniSTS	RGSC3.4
Celera	3	138,761,933 - 138,762,180	UniSTS
Cytogenetic Map	3	q41	UniSTS

RH142919

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	139,984,527 - 139,984,767 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	146,987,135 - 146,987,374	NCBI	Rnor6.0
Rnor_5.0	3	153,343,993 - 153,344,232	UniSTS	Rnor5.0
RGSC_v3.4	3	141,805,498 - 141,805,737	UniSTS	RGSC3.4
Celera	3	138,743,894 - 138,744,133	UniSTS
RH 3.4 Map	3	1196.29	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB002086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y10769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011654 ⟹ ENSRNOP00000011654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	139,978,301 - 140,002,844 (+)	Ensembl
Rnor_6.0 Ensembl	3	146,980,923 - 147,005,439 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090211 ⟹ ENSRNOP00000074814

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	139,978,415 - 140,002,868 (+)	Ensembl
Rnor_6.0 Ensembl	3	146,981,984 - 147,005,439 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112578 ⟹ ENSRNOP00000085721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	139,978,974 - 140,002,864 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119681 ⟹ ENSRNOP00000084299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	139,978,403 - 140,002,870 (+)	Ensembl

RefSeq Acc Id:

NM_031981 ⟹ NP_114187

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	160,438,708 - 160,463,259 (+)	NCBI
mRatBN7.2	3	139,978,316 - 140,002,868 (+)	NCBI
Rnor_6.0	3	146,980,923 - 147,005,470 (+)	NCBI
Rnor_5.0	3	153,337,781 - 153,361,989 (+)	NCBI
RGSC_v3.4	3	141,799,286 - 141,823,762 (+)	RGD
Celera	3	138,737,682 - 138,762,227 (+)	RGD

Sequence:

show sequence

GCCAGGCGCCCTGCCGCTGGACACTGTAGAACGGCGGGCGGAACGCAGACCTGGGTTCGGGCTG
TTGCAGTGTCCGCCGGAGCGGTTTGGGGAGTGCACGGGGTGAAGATGGCGGAGGAGCGGCAGGA
CGCGTTGAGGGAGTTCGTGGCGGTGACGGGCGCTGAGGAGGACCGGGCCCGTTTCTTCTTGGAG
TCAGCTGGCTGGGACCTGCAGATTGCACTTGCAAGCTTTTATGAGGATGGAGGGGATGAAGACA
TTGTGACCATTTCACAGGCAACCCCAAGTTCAGTGTCCAGAGGCACAGCTCCTAGTGATAATAG
AGTAACATCCTTCAGAGACCTCATTCATGACCAAGATGAAGAGGAAGAGGAAGAAGAGGGACAG
AGGTTTTATGCTGGGGGCTCAGAGAGAAGTGGACAGCAGATTGTTGGTCCTCCCCGGAAGAAAA
GTCCCAACGAGCTGGTGGATGATCTGTTTAAGGGTGCCAAAGAGCATGGGGCTGTAGCTGTGGA
ACGAGTGACCAAGAGCCCTGGAGAGACCAGTAAACCGAGACCATTTGCAGGAGGGGGCTACCGC
CTTGGAGCAGCACCAGAAGAGGAGTCTGCCTATGTGGCAGGAGAAAGGAGGCGGCATTCAGGCC
AGGATGTTCATGTAGTGCTAAAGCTCTGGAAAACTGGATTCAGCCTAGACAATGGTGACCTTAG
AAGCTACCAAGACCCATCCAATGCCCAGTTTCTGGAGTCTATCCGTAGAGGGGAGGTTCCTGCA
GAGCTTCGGAGGTTAGCTCACGGTGGGCAGGTGAACTTGGATATGGAGGATCATCGGGACGAGG
ACTTCGTGAAGCCCAAGGGAGCTTTCAAAGCCTTCACTGGCGAGGGCCAGAAACTAGGCAGCAC
GGCCCCGCAGGTTTTAAACACCAGCTCTCCAGCCCAGCAAGCAGAAAATGAAGCCAAAGCTAGC
TCGTCCATCTTAATCAATGAGGCAGAACCTACCACGAACATCCAAATCCGACTGGCAGATGGCG
GGAGACTGGTGCAGAAATTCAACCACAGCCACAGGATCAGCGACATCCGGCTCTTCATCGTGGA
TGCACGGCCGGCTATGGCTGCCACCAGTTTTGTCCTTATGACTACCTTCCCTAACAAAGAGCTG
GCTGATGAGAACCAAACCCTGAAGGAAGCCAATCTTCTCAACGCTGTCATCGTGCAGCGGTTAA
CATAACCGCCCAGCTGCTGCCTCACCTCCCTATGTGTCCCCCATGACTGTGGCCATGCCCGTGG
GGATTACCTCCTGCCCCCTGTACACCTAGCTCTTCCAGTGCCACGTCTCGTCCGTAGCTCTGGA
TTCTTAGACTTCAGTTGGACATTTGTTTTCTCTTTAGTTGTATTTCCTGGGTTTTTGTGATGAT
CAATGGACTTTAAAGAAAAAAAATAAAAAACACAAAAAATTG

hide sequence

RefSeq Acc Id:

XM_063284677 ⟹ XP_063140747

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	160,447,969 - 160,463,261 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_114187	(Get FASTA)	NCBI Sequence Viewer
	XP_063140747	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH72464	(Get FASTA)	NCBI Sequence Viewer
	BAA21659	(Get FASTA)	NCBI Sequence Viewer
	CAA71742	(Get FASTA)	NCBI Sequence Viewer
	EDL86121	(Get FASTA)	NCBI Sequence Viewer
	EDL86122	(Get FASTA)	NCBI Sequence Viewer
	EDL86123	(Get FASTA)	NCBI Sequence Viewer
	EDL86124	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011654.4
	ENSRNOP00000074814.2
	ENSRNOP00000084299.1
	ENSRNOP00000085721.1
GenBank Protein	O35987	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114187 ⟸ NM_031981

- UniProtKB:

O35987 (UniProtKB/Swiss-Prot), A6KHI1 (UniProtKB/TrEMBL), A0A0G2K911 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRG
TAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKE
HGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHVVLKLWKTGFS
LDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGE
GQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISD
IRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT

hide sequence

Ensembl Acc Id:

ENSRNOP00000074814 ⟸ ENSRNOT00000090211

Ensembl Acc Id:

ENSRNOP00000011654 ⟸ ENSRNOT00000011654

Ensembl Acc Id:

ENSRNOP00000085721 ⟸ ENSRNOT00000112578

Ensembl Acc Id:

ENSRNOP00000084299 ⟸ ENSRNOT00000119681

RefSeq Acc Id:	XP_063140747 ⟸ XM_063284677
- Peptide Label:	isoform X1
- UniProtKB:	A6KHI3 (UniProtKB/TrEMBL)

Protein Domains

SEP UBX

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35987-F1-model_v2	AlphaFold	O35987	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692522

Promoter ID:

EPDNEW_R3047

Type:

multiple initiation site

Name:

Nsfl1c_1

Description:

NSFL1 cofactor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	146,981,018 - 146,981,078	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619952	AgrOrtholog
BIND	130679
	130680
	130681
	130683
BioCyc Gene	G2FUF-47314	BioCyc
Ensembl Genes	ENSRNOG00000008604	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011654.7	UniProtKB/TrEMBL
	ENSRNOT00000090211.2	UniProtKB/TrEMBL
	ENSRNOT00000112578.1	UniProtKB/TrEMBL
	ENSRNOT00000119681.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.420.210	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7096463	IMAGE-MGC_LOAD
InterPro	NSFL1C_SEP_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SEP_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBA-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBX_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83809	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91611	IMAGE-MGC_LOAD
NCBI Gene	83809	ENTREZGENE
PANTHER	NSFL1 COFACTOR P47	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBX DOMAIN CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBA_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nsfl1c	PhenoGen
PROSITE	SEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008604	RatGTEx
SMART	SEP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF102848	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF46934	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF54236	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K911	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A2Y8_RAT	UniProtKB/TrEMBL
	A0A8I6GA62_RAT	UniProtKB/TrEMBL
	A0A8L2Q670_RAT	UniProtKB/TrEMBL
	A6KHI1	ENTREZGENE, UniProtKB/TrEMBL
	A6KHI2_RAT	UniProtKB/TrEMBL
	A6KHI3	ENTREZGENE, UniProtKB/TrEMBL
	A6KHI4_RAT	UniProtKB/TrEMBL
	NSF1C_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	Nsfl1c	NSFL1 cofactor	Nsfl1c	NSFL1 (p97) cofactor (p47)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Nsfl1c	NSFL1 (p97) cofactor (p47)	p47	p47 protein	Symbol and Name updated	1299863	APPROVED
2002-08-07	p47	p47 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)