Advanced Search (OLGA)

Gene: Itpka (inositol-trisphosphate 3-kinase A) Rattus norvegicus

Analyze

Symbol:

Itpka

Name:

inositol-trisphosphate 3-kinase A

RGD ID:

619950

Description:

Enables calcium/calmodulin-dependent protein kinase activity; inositol-1,4,5-trisphosphate 3-kinase activity; and small GTPase binding activity. Involved in modification of postsynaptic actin cytoskeleton. Acts upstream of or within actin cytoskeleton organization; dendritic spine maintenance; and positive regulation of dendritic spine morphogenesis. Located in dendritic spine. Is active in glutamatergic synapse and postsynaptic actin cytoskeleton. Orthologous to human ITPKA (inositol-trisphosphate 3-kinase A); PARTICIPATES IN inositol metabolic pathway; inositol phosphate metabolic pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,3,5-trinitro-1,3,5-triazinane; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

inositol 1,4,5-triphosphate 3-kinase; inositol 1,4,5-trisphosphate 3-kinase A; inositol 145-triphosphate 3-kinase; insP 3-kinase A; IP3 3-kinase A; IP3K A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ITPKA (inositol-trisphosphate 3-kinase A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Itpka (inositol 1,4,5-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Itpka (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ITPKA (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ITPKA (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Itpka (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ITPKA (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ITPKA (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Itpka (inositol-trisphosphate 3-kinase A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DSC2 (desmocollin 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ITPKA (inositol-trisphosphate 3-kinase A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Itpka (inositol 1,4,5-trisphosphate 3-kinase A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	itpka (inositol-trisphosphate 3-kinase A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lfe-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	IP3K2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	fxyd6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	itpka	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	itpka	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	127,179,841 - 127,188,405 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	127,179,808 - 127,188,414 (+)	Ensembl				GRCr8
mRatBN7.2	3	106,726,036 - 106,734,601 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,726,036 - 106,734,600 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	110,401,341 - 110,409,898 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,996,888 - 119,005,445 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	116,657,281 - 116,665,838 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	111,545,007 - 111,553,605 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	111,545,007 - 111,553,604 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	118,093,293 - 118,102,060 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	106,257,482 - 106,266,160 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	105,636,919 - 105,645,481 (+)	NCBI		Celera
RGSC_v3.1	3	106,153,909 - 106,162,588 (+)	NCBI
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

mosaic variegated aneuploidy syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

caffeine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dextran sulfate (ISO)

diazinon (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

endosulfan (EXP)

ethanol (ISO)

fluoxetine (EXP)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glucose (ISO)

inulin (ISO)

ketamine (EXP)

L-methionine (ISO)

metacetamol (ISO)

methapyrilene (ISO)

methotrexate (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IGI,IMP)

cellular response to calcium ion (IEA,ISO,ISS)

dendritic spine maintenance (IMP)

inositol metabolic process (IEA,ISO)

inositol phosphate biosynthetic process (IBA,IEA)

modification of postsynaptic actin cytoskeleton (IDA,IEP,IMP)

phosphatidylinositol phosphate biosynthetic process (IBA,IEA,ISO,ISS)

positive regulation of dendritic spine morphogenesis (IMP)

regulation of synaptic plasticity (IEA,ISO)

response to calcium ion (IEA,ISO,ISS)

Cellular Component

cytoplasm (IBA,IEA)

cytoskeleton (IEA,ISO,ISS)

dendritic spine (IDA)

glutamatergic synapse (IDA,IEP,IMP)

nucleus (IBA)

postsynaptic actin cytoskeleton (IDA,IMP)

Molecular Function

ATP binding (IEA)

calcium/calmodulin-dependent protein kinase activity (IDA)

calmodulin binding (IEA)

inositol hexakisphosphate kinase activity (IBA)

inositol-1,4,5-trisphosphate 3-kinase activity (IDA,IEA,IMP,ISO)

kinase activity (IEA)

nucleotide binding (IEA)

small GTPase binding (IDA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

inositol metabolic pathway (ISO)

inositol phosphate metabolic pathway (IEA,ISO)

phosphatidylinositol 3-kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and expression of a complementary DNA for inositol 1,4,5-trisphosphate 3-kinase.	Choi KY, etal., Science 1990 Apr 6;248(4951):64-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Inositol 1,4,5-trisphosphate 3-kinase a functions as a scaffold for synaptic Rac signaling.	Kim IH, etal., J Neurosci. 2009 Nov 4;29(44):14039-49. doi: 10.1523/JNEUROSCI.2483-09.2009.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Cloning and expression in Escherichia coli of a rat brain cDNA encoding a Ca2+/calmodulin-sensitive inositol 1,4,5-trisphosphate 3-kinase.	Takazawa K, etal., Biochem J 1990 Nov 15;272(1):107-12.

Additional References at PubMed

PMID:7646431	PMID:8889548	PMID:10454357	PMID:12527368	PMID:15093681	PMID:15350215	PMID:15537642	PMID:19292454	PMID:19846664	PMID:20131911	PMID:22384237	PMID:22389500
PMID:30053369

Genomics

Comparative Map Data

Itpka
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	127,179,841 - 127,188,405 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	127,179,808 - 127,188,414 (+)	Ensembl				GRCr8
mRatBN7.2	3	106,726,036 - 106,734,601 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,726,036 - 106,734,600 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	110,401,341 - 110,409,898 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,996,888 - 119,005,445 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	116,657,281 - 116,665,838 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	111,545,007 - 111,553,605 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	111,545,007 - 111,553,604 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	118,093,293 - 118,102,060 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	106,257,482 - 106,266,160 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	105,636,919 - 105,645,481 (+)	NCBI		Celera
RGSC_v3.1	3	106,153,909 - 106,162,588 (+)	NCBI
Cytogenetic Map	3	q35	NCBI

ITPKA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	41,493,874 - 41,503,551 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	41,493,393 - 41,503,551 (+)	Ensembl			hg38	GRCh38
GRCh37	15	41,786,072 - 41,795,749 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	39,573,414 - 39,583,039 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	39,573,413 - 39,583,037	NCBI
Celera	15	18,554,082 - 18,563,706 (+)	NCBI		Celera
Cytogenetic Map	15	q15.1	NCBI
HuRef	15	18,634,270 - 18,643,970 (+)	NCBI		HuRef
CHM1_1	15	41,904,654 - 41,914,323 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	39,300,037 - 39,309,713 (+)	NCBI		T2T-CHM13v2.0

Itpka
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	119,572,818 - 119,581,734 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	119,572,818 - 119,581,744 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	119,742,337 - 119,751,253 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	119,742,337 - 119,751,263 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	119,568,073 - 119,576,989 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	119,433,778 - 119,442,694 (+)	NCBI		MGSCv36	mm8
Celera	2	120,898,643 - 120,907,740 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	59.97	NCBI

Itpka
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	8,299,318 - 8,309,865 (+)	Ensembl
ChiLan1.0	NW_004955416	8,300,059 - 8,310,225 (+)	NCBI	ChiLan1.0	ChiLan1.0

ITPKA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	30,735,096 - 30,744,968 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	34,886,349 - 34,896,201 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	20,434,532 - 20,444,389 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	38,663,857 - 38,685,172 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	38,675,600 - 38,684,779 (+)	Ensembl			panPan2	panpan1.1

ITPKA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	8,532,191 - 8,541,273 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	8,532,284 - 8,541,285 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	8,591,175 - 8,600,076 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	8,666,590 - 8,675,492 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	8,666,590 - 8,675,501 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	8,587,903 - 8,596,796 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	8,695,316 - 8,704,204 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	8,827,050 - 8,835,956 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Itpka
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	86,992,042 - 87,000,822 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	4,840,152 - 4,848,881 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	4,840,113 - 4,848,881 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ITPKA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	129,867,642 - 129,875,639 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	129,867,261 - 129,877,762 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	144,939,082 - 144,947,563 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ITPKA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	41,502,417 - 41,512,131 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	99,468,986 - 99,479,279 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Itpka
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	8,655,777 - 8,664,600 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624804	8,655,762 - 8,664,599 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Itpka
40 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	49
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000007247
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	122654702	136118980	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	116582412	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	104545086	149545086	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	112250810	157250810	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	101255536	134750886	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	117537367	162537367	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	125116475	170116475	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	110225882	155225882	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	122395989	167395989	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	125814931	139636791	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	110634702	155634702	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	116188400	161188400	Rat

Markers in Region

RH130923

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	106,734,384 - 106,734,572 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	111,553,389 - 111,553,576	NCBI	Rnor6.0
Rnor_5.0	3	118,101,844 - 118,102,031	UniSTS	Rnor5.0
RGSC_v3.4	3	106,265,955 - 106,266,142	UniSTS	RGSC3.4
Celera	3	105,645,265 - 105,645,452	UniSTS
RH 3.4 Map	3	917.7	UniSTS
Cytogenetic Map	3	q35	UniSTS

BE106366

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	106,734,718 - 106,734,882 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	111,553,723 - 111,553,886	NCBI	Rnor6.0
Rnor_5.0	3	118,102,178 - 118,102,341	UniSTS	Rnor5.0
RGSC_v3.4	3	106,266,289 - 106,266,452	UniSTS	RGSC3.4
Celera	3	105,645,599 - 105,645,762	UniSTS
RH 3.4 Map	3	921.1	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	67	138	91	90	59	76	59	6	324	173	11	117	70	91	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ204027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M29787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X56917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007247 ⟹ ENSRNOP00000007247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	127,179,808 - 127,188,414 (+)	Ensembl
mRatBN7.2 Ensembl	3	106,726,036 - 106,734,600 (+)	Ensembl
Rnor_6.0 Ensembl	3	111,545,007 - 111,553,604 (+)	Ensembl

RefSeq Acc Id:

NM_031045 ⟹ NP_112307

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	127,179,841 - 127,188,405 (+)	NCBI
mRatBN7.2	3	106,726,036 - 106,734,601 (+)	NCBI
Rnor_6.0	3	111,545,007 - 111,553,605 (+)	NCBI
Rnor_5.0	3	118,093,293 - 118,102,060 (+)	NCBI
RGSC_v3.4	3	106,257,482 - 106,266,160 (+)	RGD
Celera	3	105,636,919 - 105,645,481 (+)	NCBI

Sequence:

show sequence

CGCGCCGCGGGCTGGTGGGCTCGGCTGCCGCTCCGGTGTCGGGAGATGACCCTGCCCGGACACC
CGACGGGCATGGCGCGACCACGGGGCGCGGGGCCCTGCAGCCCCGGGTTGGAGCGGGCTCCGCG
CCGGAGCGTCGGGGAGCTGCGCCTGCTCTTCGAAGCGCGCTGCGCCGCAGTCGCCGCCGCAGCG
GCCGCAGGGGAGCCCCGGGCCCGCGGGGCCAAGCGGCGTGGGGGACAAGTGCCTAACGGGCTCC
CGCGTGCTGCCCCTGCTCCGGTGATCCCGCAGCTCACTGTGACAAGCGAGGAGGATGTGGCCCC
GGCCAGCCCCGGGCCGCCGGACCGGGAGGGGAACTGGCTCCCAGCTGCGGGGTCGCACCTGCAG
CAGCCACGCCGCCTCTCCACCTCGTCCCTCTCCTCCACCGGCTCCTCGTCGCTGCTCGAGGACT
CGGAGGACGACCTGCTGAGCGACAGCGAGAGCCGGAGCCGCGGCAACGTGCAGCTGGAAACCAG
CGAAGACGTGGGGCAGAAAAGCCATTGGCAGAAGATCCGTACCATGGTCAACCTGCCTGTCATG
AGTCCTTTCAAAAAGCGCTACTCCTGGGTGCAGTTAGCAGGGCACACAGGGAGTTTCAAAGCTG
CGGGCACCAGCGGCCTGATCCTGAAGCGCAGCTCGGAGCCTGAACACTACTGCCTGGTGCGGTT
GATGGCTGATGTGCTGCGTGGGTGTGTGCCGGCCTTCCACGGTGTGGTCGAGCGGGATGGTGAA
AGCTACTTACAGTTACAGGACCTGCTTGATGGCTTCGATGGACCTTGCGTGCTTGACTGCAAGA
TGGGTGTCAGAACTTACCTGGAAGAAGAGCTGACCAAAGCCCGAGAACGGCCCAAGCTGCGAAA
GGACATGTATAAGAAAATGCTGGCCGTGGACCCCGAGGCACCTACTGAGGAGGAGCATGCGCAG
CGTGCCGTCACAAAACCTCGATACATGCAATGGCGCGAAGGCATCAGCTCCAGCACTACACTCG
GCTTCCGCATCGAGGGCATCAAGAAAGCCGATGGATCTTGCAGTACTGATTTCAAAACTACACG
AAGCAGAGAGCAAGTGACTCGAGTCTTTGAGGAGTTCATGCAAGGAGATGCTGAAGTGCTGAAG
AGGTATCTGAACCGCCTACAGCAGATCCGGGATACCCTGGAGATCTCTGATTTCTTTAGACGGC
ACGAGGTGATTGGCAGCTCACTCCTCTTCGTGCATGACCATTGCCATCGCGCTGGTGTGTGGCT
CATCGATTTTGGCAAGACCACGCCTCTCCCCGATGGCCAGATCCTGGATCATCGGAGGCCCTGG
GAGGAGGGCAATCGTGAGGACGGCTATTTGCTGGGGCTGGACAATCTCATTGGCATCTTGGCCA
ACCTGGCTGAGAGATGAGGCTGGGCCCTTTTCCCTCAGCTTGGGCCAGCTGGTCAGAGATGTGG
ACCTGTGGCTGCATCCCCACCATGCATGCCGGCAAGAGACTGGAACCCCGCTGGGCGGGCAGTT
CACATGGTCCTGGAGGACCAGGTGCCATCCACTAAGGGGGTGTAGTACATTAGGAGCTGGCTTC
TACACAAGCCTGTCTCCCAGAGCTGAATGACACTAATTTATAGGAGAGGAAGGAAACAGTGGGC
TTCTCCCCCAGCCTTGTCAAGTGACTTTGCACCTCTCCAGAGGGTCCCGATCCAGAATTGTACT
TCACAGTTATATAGACTTACTGGTCTAACTTCCTACACTACCATGGACACCCTTCCTAATAAAA
CTCAAAGATTCAGCTTCTGTGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105917 ⟹ XP_038961845

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	127,180,810 - 127,188,395 (+)	NCBI
mRatBN7.2	3	106,726,744 - 106,734,593 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112307	(Get FASTA)	NCBI Sequence Viewer
	XP_038961845	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41457	(Get FASTA)	NCBI Sequence Viewer
	CAA40248	(Get FASTA)	NCBI Sequence Viewer
	EDL79923	(Get FASTA)	NCBI Sequence Viewer
	EDL79924	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007247
	ENSRNOP00000007247.1
GenBank Protein	P17105	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112307 ⟸ NM_031045

- UniProtKB:

P17105 (UniProtKB/Swiss-Prot), A6HPH2 (UniProtKB/TrEMBL), A6HPH3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTLPGHPTGMARPRGAGPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGG
QVPNGLPRAAPAPVIPQLTVTSEEDVAPASPGPPDREGNWLPAAGSHLQQPRRLSTSSLSSTGS
SSLLEDSEDDLLSDSESRSRGNVQLETSEDVGQKSHWQKIRTMVNLPVMSPFKKRYSWVQLAGH
TGSFKAAGTSGLILKRSSEPEHYCLVRLMADVLRGCVPAFHGVVERDGESYLQLQDLLDGFDGP
CVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGI
SSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVTRVFEEFMQGDAEVLKRYLNRLQQIRDTLEI
SDFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDN
LIGILANLAER

hide sequence

Ensembl Acc Id:

ENSRNOP00000007247 ⟸ ENSRNOT00000007247

RefSeq Acc Id:	XP_038961845 ⟸ XM_039105917
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17105-F1-model_v2	AlphaFold	P17105	1-459	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692335

Promoter ID:

EPDNEW_R2858

Type:

initiation region

Name:

Itpka_1

Description:

inositol-trisphosphate 3-kinase A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	111,544,998 - 111,545,058	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619950	AgrOrtholog
BioCyc Gene	G2FUF-48192	BioCyc
BioCyc Pathway	PWY-6361 [1D-myo-inositol hexakisphosphate biosynthesis I (from Ins(1,4,5)P3)]	BioCyc
	PWY-6362 [1D-myo-inositol hexakisphosphate biosynthesis II (mammalian)]	BioCyc
	PWY-6364 [D-myo-inositol (1,3,4)-trisphosphate biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6361	BioCyc
	PWY-6362	BioCyc
	PWY-6364	BioCyc
Ensembl Genes	ENSRNOG00000005284	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007247	ENTREZGENE
	ENSRNOT00000007247.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.470.160	UniProtKB/Swiss-Prot
InterPro	IPK	UniProtKB/Swiss-Prot
	IPK_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:81677	UniProtKB/Swiss-Prot
NCBI Gene	81677	ENTREZGENE
PANTHER	INOSITOL-TRISPHOSPHATE 3-KINASE A	UniProtKB/Swiss-Prot
	PTHR12400	UniProtKB/Swiss-Prot
Pfam	IPK	UniProtKB/Swiss-Prot
PhenoGen	Itpka	PhenoGen
RatGTEx	ENSRNOG00000005284	RatGTEx
Superfamily-SCOP	SAICAR synthase-like	UniProtKB/Swiss-Prot
UniProt	A6HPH2	ENTREZGENE, UniProtKB/TrEMBL
	A6HPH3	ENTREZGENE, UniProtKB/TrEMBL
	IP3KA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Itpka	inositol-trisphosphate 3-kinase A	Itpka	inositol 1,4,5-trisphosphate 3-kinase A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Itpka	inositol 1,4,5-trisphosphate 3-kinase A		inositol 1,4,5-triphosphate 3-kinase	Name updated	1299863	APPROVED
2002-08-07	Itpka	inositol 1,4,5-triphosphate 3-kinase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains calmodulin-binding site and six regions with amino acid compositions (PEST regions) common to proteins that are susceptible to calpain	633125
gene_regulation	activity stimulated by Ca2+ in the presence of calmodulin	633124

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways