Symbol:
Itpka
Name:
inositol-trisphosphate 3-kinase A
RGD ID:
619950
Description:
Enables calcium/calmodulin-dependent protein kinase activity; inositol-1,4,5-trisphosphate 3-kinase activity; and small GTPase binding activity. Involved in modification of postsynaptic actin cytoskeleton. Acts upstream of or within actin cytoskeleton organization; dendritic spine maintenance; and positive regulation of dendritic spine morphogenesis. Located in dendritic spine. Is active in glutamatergic synapse and postsynaptic actin cytoskeleton. Orthologous to human ITPKA (inositol-trisphosphate 3-kinase A); PARTICIPATES IN inositol metabolic pathway; inositol phosphate metabolic pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,3,5-trinitro-1,3,5-triazinane; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
inositol 1,4,5-triphosphate 3-kinase; inositol 1,4,5-trisphosphate 3-kinase A; inositol 145-triphosphate 3-kinase; insP 3-kinase A; IP3 3-kinase A; IP3K A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITPKA (inositol-trisphosphate 3-kinase A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Itpka (inositol 1,4,5-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Itpka (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITPKA (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITPKA (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itpka (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITPKA (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITPKA (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itpka (inositol-trisphosphate 3-kinase A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DSC2 (desmocollin 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ITPKA (inositol-trisphosphate 3-kinase A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Itpka (inositol 1,4,5-trisphosphate 3-kinase A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
itpka (inositol-trisphosphate 3-kinase A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
lfe-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
IP3K2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
fxyd6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
itpka
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 127,179,841 - 127,188,405 (+) NCBI GRCr8 mRatBN7.2 3 106,726,036 - 106,734,601 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 106,726,036 - 106,734,600 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 110,401,341 - 110,409,898 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 118,996,888 - 119,005,445 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 116,657,281 - 116,665,838 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 111,545,007 - 111,553,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 111,545,007 - 111,553,604 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 118,093,293 - 118,102,060 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 106,257,482 - 106,266,160 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 106,153,909 - 106,162,588 (+) NCBI Celera 3 105,636,919 - 105,645,481 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itpka Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ITPKA mRNA] CTD PMID:31150632 Itpka Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:732604 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Itpka Rat 1,2-dichloroethane decreases expression ISO RGD:732604 6480464 ethylene dichloride results in decreased expression of ITPKA mRNA CTD PMID:28960355 Itpka Rat 1,2-dimethylhydrazine decreases expression ISO RGD:732604 6480464 1,2-Dimethylhydrazine results in decreased expression of ITPKA mRNA CTD PMID:22206623 Itpka Rat 1,3,5-trinitro-1,3,5-triazinane decreases expression EXP 6480464 cyclonite results in decreased expression of ITPKA mRNA CTD PMID:25559034 Itpka Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:732604 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Itpka Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:732604 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Itpka Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732603 6480464 Tetrachlorodibenzodioxin affects the expression of ITPKA mRNA CTD PMID:22298810 Itpka Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITPKA mRNA CTD PMID:33387578 Itpka Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732604 6480464 Tetrachlorodibenzodioxin affects the expression of ITPKA mRNA CTD PMID:26377647 Itpka Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:732603 6480464 ITPKA mRNA affects the reaction [Tetrachlorodibenzodioxin results in increased activity of CYP1A1 protein] CTD PMID:21479225 Itpka Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732603 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITPKA mRNA CTD PMID:20106945|PMID:21632981 Itpka Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:732604 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Itpka Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of ITPKA mRNA CTD PMID:21346803 Itpka Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:732604 6480464 4,4'-diaminodiphenylmethane results in decreased expression of ITPKA mRNA CTD PMID:18648102 Itpka Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:732604 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ITPKA mRNA CTD PMID:30951980 Itpka Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:732604 6480464 bisphenol S affects the methylation of ITPKA gene CTD PMID:31683443 Itpka Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:732604 6480464 Fenretinide results in increased expression of ITPKA mRNA CTD PMID:28973697 Itpka Rat all-trans-retinoic acid decreases expression ISO RGD:732604 6480464 Tretinoin results in decreased expression of ITPKA mRNA CTD PMID:16788091 Itpka Rat all-trans-retinoic acid multiple interactions ISO RGD:732604 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of ITPKA mRNA CTD PMID:30951980 Itpka Rat all-trans-retinoic acid increases expression ISO RGD:732603 6480464 Tretinoin results in increased expression of ITPKA mRNA CTD PMID:23724009 Itpka Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ITPKA mRNA CTD PMID:16483693 Itpka Rat aristolochic acid A increases expression ISO RGD:732603 6480464 aristolochic acid I results in increased expression of ITPKA mRNA CTD PMID:33212167 Itpka Rat arsane multiple interactions ISO RGD:732603 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ITPKA more ... CTD PMID:32525701 Itpka Rat arsenic atom multiple interactions ISO RGD:732603 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ITPKA more ... CTD PMID:32525701 Itpka Rat arsenite(3-) decreases expression ISO RGD:732604 6480464 arsenite results in decreased expression of ITPKA protein CTD PMID:37955338 Itpka Rat Azoxymethane multiple interactions ISO RGD:732604 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPKA more ... CTD PMID:29950665 Itpka Rat benzo[a]pyrene decreases expression ISO RGD:732603 6480464 Benzo(a)pyrene results in decreased expression of ITPKA mRNA CTD PMID:20106945 Itpka Rat benzo[a]pyrene multiple interactions ISO RGD:732604 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ITPKA mRNA] CTD PMID:22228805 Itpka Rat benzo[a]pyrene decreases expression ISO RGD:732604 6480464 Benzo(a)pyrene results in decreased expression of ITPKA mRNA CTD PMID:22228805 Itpka Rat benzo[e]pyrene increases methylation ISO RGD:732603 6480464 benzo(e)pyrene results in increased methylation of ITPKA polyA tail CTD PMID:30157460 Itpka Rat beta-lapachone increases expression ISO RGD:732603 6480464 beta-lapachone results in increased expression of ITPKA mRNA CTD PMID:38218311 Itpka Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ITPKA mRNA CTD PMID:25181051 Itpka Rat bisphenol A increases expression ISO RGD:732604 6480464 bisphenol A results in increased expression of ITPKA mRNA CTD PMID:32156529 Itpka Rat bisphenol A multiple interactions ISO RGD:732603 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ITPKA gene CTD PMID:31601247 Itpka Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITPKA mRNA CTD PMID:34947998 Itpka Rat bisphenol A increases methylation ISO RGD:732604 6480464 bisphenol A results in increased methylation of ITPKA promoter CTD PMID:27312807 Itpka Rat butanal increases expression ISO RGD:732603 6480464 butyraldehyde results in increased expression of ITPKA mRNA CTD PMID:26079696 Itpka Rat caffeine affects phosphorylation ISO RGD:732603 6480464 Caffeine affects the phosphorylation of ITPKA protein CTD PMID:35688186 Itpka Rat carbon nanotube decreases expression ISO RGD:732604 6480464 Nanotubes, Carbon analog results in decreased expression of ITPKA mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Itpka Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of ITPKA mRNA CTD PMID:18500788 Itpka Rat chlorpyrifos increases expression ISO RGD:732604 6480464 Chlorpyrifos results in increased expression of ITPKA mRNA CTD PMID:37019170 Itpka Rat choline multiple interactions ISO RGD:732604 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Itpka Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ITPKA mRNA CTD PMID:22023808 Itpka Rat copper(II) sulfate decreases expression ISO RGD:732603 6480464 Copper Sulfate results in decreased expression of ITPKA mRNA CTD PMID:19549813 Itpka Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ITPKA mRNA CTD PMID:26577399 Itpka Rat cyclosporin A increases expression ISO RGD:732603 6480464 Cyclosporine results in increased expression of ITPKA mRNA CTD PMID:20106945|PMID:25562108|PMID:27989131 Itpka Rat DDE decreases expression ISO RGD:732603 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ITPKA mRNA CTD PMID:38568856 Itpka Rat dextran sulfate multiple interactions ISO RGD:732604 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPKA more ... CTD PMID:29950665 Itpka Rat diazinon increases methylation ISO RGD:732603 6480464 Diazinon results in increased methylation of ITPKA gene CTD PMID:22964155 Itpka Rat dibenz[a,h]anthracene decreases expression ISO RGD:732604 6480464 1,2,5,6-dibenzanthracene results in decreased expression of ITPKA mRNA CTD PMID:26377693 Itpka Rat dibutyl phthalate decreases expression ISO RGD:732604 6480464 Dibutyl Phthalate results in decreased expression of ITPKA mRNA CTD PMID:17361019|PMID:21266533 Itpka Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ITPKA mRNA CTD PMID:29391264 Itpka Rat ethanol affects expression ISO RGD:732604 6480464 Ethanol affects the expression of ITPKA mRNA CTD PMID:30319688 Itpka Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of ITPKA mRNA CTD PMID:17033635 Itpka Rat folic acid multiple interactions ISO RGD:732604 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Itpka Rat fulvestrant multiple interactions ISO RGD:732603 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ITPKA gene CTD PMID:31601247 Itpka Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ITPKA mRNA CTD PMID:33387578 Itpka Rat inulin multiple interactions ISO RGD:732604 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ITPKA mRNA CTD PMID:36331819 Itpka Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of ITPKA mRNA CTD PMID:20080153 Itpka Rat L-methionine multiple interactions ISO RGD:732604 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Itpka Rat metacetamol decreases expression ISO RGD:732604 6480464 3-hydroxyacetanilide results in decreased expression of ITPKA mRNA CTD PMID:18544908 Itpka Rat methapyrilene increases methylation ISO RGD:732603 6480464 Methapyrilene results in increased methylation of ITPKA polyA tail CTD PMID:30157460 Itpka Rat methotrexate affects expression ISO RGD:732604 6480464 Methotrexate affects the expression of ITPKA mRNA CTD PMID:18502557 Itpka Rat okadaic acid increases expression ISO RGD:732603 6480464 Okadaic Acid results in increased expression of ITPKA mRNA CTD PMID:38832940 Itpka Rat paracetamol decreases expression ISO RGD:732604 6480464 Acetaminophen results in decreased expression of ITPKA mRNA CTD PMID:18544908 Itpka Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ITPKA mRNA CTD PMID:33387578 Itpka Rat paracetamol increases expression ISO RGD:732603 6480464 Acetaminophen results in increased expression of ITPKA mRNA CTD PMID:29067470 Itpka Rat paracetamol affects expression ISO RGD:732604 6480464 Acetaminophen affects the expression of ITPKA mRNA CTD PMID:17562736 Itpka Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ITPKA mRNA CTD PMID:32680482 Itpka Rat PCB138 multiple interactions ISO RGD:732604 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Itpka Rat perfluorononanoic acid increases expression ISO RGD:732603 6480464 perfluoro-n-nonanoic acid results in increased expression of ITPKA mRNA CTD PMID:32588087 Itpka Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of ITPKA mRNA CTD PMID:20136073 Itpka Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:732604 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ITPKA mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Itpka Rat perfluorooctanoic acid increases expression ISO RGD:732603 6480464 perfluorooctanoic acid results in increased expression of ITPKA mRNA CTD PMID:32588087 Itpka Rat phenobarbital increases expression ISO RGD:732603 6480464 Phenobarbital results in increased expression of ITPKA mRNA CTD PMID:19084549 Itpka Rat phenobarbital affects expression ISO RGD:732603 6480464 Phenobarbital affects the expression of ITPKA mRNA CTD PMID:19159669 Itpka Rat pirinixic acid decreases expression ISO RGD:732604 6480464 pirinixic acid results in decreased expression of ITPKA mRNA CTD PMID:17426115|PMID:23811191 Itpka Rat quercetin decreases expression ISO RGD:732603 6480464 Quercetin results in decreased expression of ITPKA mRNA CTD PMID:21632981 Itpka Rat S-nitroso-N-acetyl-D-penicillamine decreases expression EXP 6480464 S-Nitroso-N-Acetylpenicillamine results in decreased expression of ITPKA mRNA CTD PMID:12102619 Itpka Rat sodium arsenate multiple interactions ISO RGD:732603 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ITPKA more ... CTD PMID:32525701 Itpka Rat sodium arsenite decreases expression ISO RGD:732604 6480464 sodium arsenite results in decreased expression of ITPKA mRNA CTD PMID:37682722 Itpka Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of ITPKA mRNA CTD PMID:19281266 Itpka Rat sunitinib increases expression ISO RGD:732603 6480464 Sunitinib results in increased expression of ITPKA mRNA CTD PMID:31533062 Itpka Rat tetrachloroethene increases expression ISO RGD:732604 6480464 Tetrachloroethylene results in increased expression of ITPKA mRNA CTD PMID:28973375 Itpka Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ITPKA mRNA CTD PMID:17805973 Itpka Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ITPKA mRNA CTD PMID:31150632 Itpka Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ITPKA mRNA] CTD PMID:31150632 Itpka Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ITPKA mRNA CTD PMID:34492290 Itpka Rat titanium dioxide affects expression ISO RGD:732604 6480464 titanium dioxide affects the expression of ITPKA mRNA CTD PMID:23557971 Itpka Rat titanium dioxide increases methylation ISO RGD:732604 6480464 titanium dioxide results in increased methylation of ITPKA gene CTD PMID:35295148 Itpka Rat titanium dioxide decreases methylation ISO RGD:732604 6480464 titanium dioxide results in decreased methylation of ITPKA gene CTD PMID:35295148 Itpka Rat titanium dioxide multiple interactions ISO RGD:732604 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITPKA more ... CTD PMID:29950665 Itpka Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ITPKA mRNA CTD PMID:33387578 Itpka Rat valproic acid increases methylation ISO RGD:732603 6480464 Valproic Acid results in increased methylation of ITPKA gene CTD PMID:29154799 Itpka Rat valproic acid increases expression ISO RGD:732604 6480464 Valproic Acid results in increased expression of ITPKA mRNA CTD PMID:21427059 Itpka Rat valproic acid increases expression ISO RGD:732603 6480464 Valproic Acid results in increased expression of ITPKA mRNA CTD PMID:23179753|PMID:29154799
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Itpka Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpka Rat calcium/calmodulin-dependent protein kinase activity IDA 633124 RGD Itpka Rat calmodulin binding enables IEA UniProtKB-KW:KW-0112 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpka Rat inositol hexakisphosphate kinase activity enables IBA MGI:1923750|PANTHER:PTN000274018|SGD:S000002424|UniProtKB:Q57X56|UniProtKB:Q92551|UniProtKB:Q96PC2|UniProtKB:Q9UHH9|dictyBase:DDB_G0278739 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity IDA 633124 RGD Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity enables IEA EC:2.7.1.127 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity enables IEA RHEA:11020 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity enables IEA UniProtKB:P23677|ensembl:ENSP00000260386 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity enables ISO RGD:732603 1624291 PMID:12747803, PMID:1847047 RGD PMID:12747803|PMID:1847047 Itpka Rat inositol-1,4,5-trisphosphate 3-kinase activity IMP 633124 RGD Itpka Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpka Rat kinase activity enables IEA InterPro:IPR005522 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Itpka Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Itpka Rat small GTPase binding enables IDA 8553536 PMID:19890013 MGI Itpka Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dinitrotoluene (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) butanal (ISO) caffeine (ISO) carbon nanotube (ISO) cefaloridine (EXP) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) dextran sulfate (ISO) diazinon (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) endosulfan (EXP) ethanol (ISO) fluoxetine (EXP) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) inulin (ISO) ketamine (EXP) L-methionine (ISO) metacetamol (ISO) methapyrilene (ISO) methotrexate (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) S-nitroso-N-acetyl-D-penicillamine (EXP) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
Biological Process
actin cytoskeleton organization (IGI,IMP) cellular response to calcium ion (IEA,ISO,ISS) dendritic spine maintenance (IMP) inositol metabolic process (IEA,ISO) inositol phosphate biosynthetic process (IBA,IEA) modification of postsynaptic actin cytoskeleton (IDA,IEP,IMP) phosphatidylinositol phosphate biosynthetic process (IBA,IEA,ISO,ISS) positive regulation of dendritic spine morphogenesis (IMP) regulation of synaptic plasticity (IEA,ISO) response to calcium ion (IEA,ISO,ISS)
1.
Molecular cloning and expression of a complementary DNA for inositol 1,4,5-trisphosphate 3-kinase.
Choi KY, etal., Science 1990 Apr 6;248(4951):64-6.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Inositol 1,4,5-trisphosphate 3-kinase a functions as a scaffold for synaptic Rac signaling.
Kim IH, etal., J Neurosci. 2009 Nov 4;29(44):14039-49. doi: 10.1523/JNEUROSCI.2483-09.2009.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Cloning and expression in Escherichia coli of a rat brain cDNA encoding a Ca2+/calmodulin-sensitive inositol 1,4,5-trisphosphate 3-kinase.
Takazawa K, etal., Biochem J 1990 Nov 15;272(1):107-12.
Itpka Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 127,179,841 - 127,188,405 (+) NCBI GRCr8 mRatBN7.2 3 106,726,036 - 106,734,601 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 106,726,036 - 106,734,600 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 110,401,341 - 110,409,898 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 118,996,888 - 119,005,445 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 116,657,281 - 116,665,838 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 111,545,007 - 111,553,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 111,545,007 - 111,553,604 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 118,093,293 - 118,102,060 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 106,257,482 - 106,266,160 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 106,153,909 - 106,162,588 (+) NCBI Celera 3 105,636,919 - 105,645,481 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
ITPKA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 41,493,874 - 41,503,551 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 41,493,393 - 41,503,551 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 41,786,072 - 41,795,749 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 39,573,414 - 39,583,039 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 39,573,413 - 39,583,037 NCBI Celera 15 18,554,082 - 18,563,706 (+) NCBI Celera Cytogenetic Map 15 q15.1 NCBI HuRef 15 18,634,270 - 18,643,970 (+) NCBI HuRef CHM1_1 15 41,904,654 - 41,914,323 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 39,300,037 - 39,309,713 (+) NCBI T2T-CHM13v2.0
Itpka Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 119,572,818 - 119,581,734 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 119,572,818 - 119,581,744 (+) Ensembl GRCm39 Ensembl GRCm38 2 119,742,337 - 119,751,253 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 119,742,337 - 119,751,263 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 119,568,073 - 119,576,989 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 119,433,778 - 119,442,694 (+) NCBI MGSCv36 mm8 Celera 2 120,898,643 - 120,907,740 (+) NCBI Celera Cytogenetic Map 2 E5 NCBI cM Map 2 59.97 NCBI
Itpka Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 8,299,318 - 8,309,865 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 8,300,059 - 8,310,225 (+) NCBI ChiLan1.0 ChiLan1.0
ITPKA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 30,735,096 - 30,744,968 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 34,886,349 - 34,896,201 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 20,434,532 - 20,444,389 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 38,663,857 - 38,685,172 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 38,675,600 - 38,684,779 (+) Ensembl panpan1.1 panPan2
ITPKA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 8,532,191 - 8,541,273 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 8,532,284 - 8,541,285 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 8,591,175 - 8,600,076 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 8,666,590 - 8,675,492 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 8,666,590 - 8,675,501 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 8,587,903 - 8,596,796 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 8,695,316 - 8,704,204 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 8,827,050 - 8,835,956 (+) NCBI UU_Cfam_GSD_1.0
Itpka Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 86,992,042 - 87,000,822 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 4,840,152 - 4,848,881 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 4,840,113 - 4,848,881 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITPKA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 129,867,642 - 129,875,639 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 129,867,261 - 129,877,762 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 144,939,082 - 144,947,563 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITPKA
Itpka
.
Predicted Target Of
Count of predictions: 61 Count of miRNA genes: 49 Interacting mature miRNAs: 56 Transcripts: ENSRNOT00000007247 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1582216 Bw65 Body weight QTL 65 6.3 body mass (VT:0001259) body weight (CMO:0000012) 3 102200529 115665732 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH130923
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 106,734,384 - 106,734,572 (+) MAPPER mRatBN7.2 Rnor_6.0 3 111,553,389 - 111,553,576 NCBI Rnor6.0 Rnor_5.0 3 118,101,844 - 118,102,031 UniSTS Rnor5.0 RGSC_v3.4 3 106,265,955 - 106,266,142 UniSTS RGSC3.4 Celera 3 105,645,265 - 105,645,452 UniSTS RH 3.4 Map 3 917.7 UniSTS Cytogenetic Map 3 q35 UniSTS
BE106366
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 106,734,718 - 106,734,882 (+) MAPPER mRatBN7.2 Rnor_6.0 3 111,553,723 - 111,553,886 NCBI Rnor6.0 Rnor_5.0 3 118,102,178 - 118,102,341 UniSTS Rnor5.0 RGSC_v3.4 3 106,266,289 - 106,266,452 UniSTS RGSC3.4 Celera 3 105,645,599 - 105,645,762 UniSTS RH 3.4 Map 3 921.1 UniSTS Cytogenetic Map 3 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
49
111
91
90
59
25
59
6
213
94
91
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007247 ⟹ ENSRNOP00000007247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 106,726,036 - 106,734,600 (+) Ensembl Rnor_6.0 Ensembl 3 111,545,007 - 111,553,604 (+) Ensembl
RefSeq Acc Id:
NM_031045 ⟹ NP_112307
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 127,179,841 - 127,188,405 (+) NCBI mRatBN7.2 3 106,726,036 - 106,734,601 (+) NCBI Rnor_6.0 3 111,545,007 - 111,553,605 (+) NCBI Rnor_5.0 3 118,093,293 - 118,102,060 (+) NCBI RGSC_v3.4 3 106,257,482 - 106,266,160 (+) RGD Celera 3 105,636,919 - 105,645,481 (+) NCBI
Sequence:
CGCGCCGCGGGCTGGTGGGCTCGGCTGCCGCTCCGGTGTCGGGAGATGACCCTGCCCGGACACCCGACGGGCATGGCGCGACCACGGGGCGCGGGGCCCTGCAGCCCCGGGTTGGAGCGGGCTCCGCG
hide sequence
RefSeq Acc Id:
XM_039105917 ⟹ XP_038961845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 127,180,810 - 127,188,395 (+) NCBI mRatBN7.2 3 106,726,744 - 106,734,593 (+) NCBI
RefSeq Acc Id:
NP_112307 ⟸ NM_031045
- UniProtKB:
P17105 (UniProtKB/Swiss-Prot), A6HPH2 (UniProtKB/TrEMBL), A6HPH3 (UniProtKB/TrEMBL)
- Sequence:
MTLPGHPTGMARPRGAGPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGLPRAAPAPVIPQLTVTSEEDVAPASPGPPDREGNWLPAAGSHLQQPRRLSTSSLSSTGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000007247 ⟸ ENSRNOT00000007247
RefSeq Acc Id:
XP_038961845 ⟸ XM_039105917
- Peptide Label:
isoform X1
RGD ID: 13692335 Promoter ID: EPDNEW_R2858 Type: initiation region Name: Itpka_1 Description: inositol-trisphosphate 3-kinase A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 111,544,998 - 111,545,058 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Itpka
inositol-trisphosphate 3-kinase A
Itpka
inositol 1,4,5-trisphosphate 3-kinase A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Itpka
inositol 1,4,5-trisphosphate 3-kinase A
inositol 1,4,5-triphosphate 3-kinase
Name updated
1299863 APPROVED
2002-08-07
Itpka
inositol 1,4,5-triphosphate 3-kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains calmodulin-binding site and six regions with amino acid compositions (PEST regions) common to proteins that are susceptible to calpain
633125
gene_regulation
activity stimulated by Ca2+ in the presence of calmodulin
633124
