Lgmn (legumain) - Rat Genome Database

Name: Lgmn
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Lgmn (legumain) Rattus norvegicus

Analyze

Symbol:

Lgmn

Name:

legumain

RGD ID:

619832

Description:

Enables cysteine-type endopeptidase activity. Predicted to be involved in several processes, including learning or memory; positive regulation of chemotaxis; and protein processing. Predicted to act upstream of or within negative regulation of neuron apoptotic process; regulation of growth; and response to acidic pH. Located in lysosome. Orthologous to human LGMN (legumain); PARTICIPATES IN antigen processing and presentation pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

asparaginyl endopeptidase; MGC105274; protease, cysteine 1; protease, cysteine, 1 (legumain); Prsc1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LGMN (legumain)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Lgmn (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lgmn (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LGMN (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LGMN (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lgmn (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LGMN (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LGMN (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lgmn (legumain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LGMN (legumain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lgmn (legumain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lgmn (legumain)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T28H10.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lgmn	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	127,308,913 - 127,347,355 (-)	NCBI		GRCr8
mRatBN7.2	6	121,544,048 - 121,582,495 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	121,544,053 - 121,582,480 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	121,684,520 - 121,722,056 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	121,979,783 - 122,017,312 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	121,315,105 - 121,353,227 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	126,282,246 - 126,308,207 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	126,282,233 - 126,320,726 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	135,492,943 - 135,518,916 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	126,668,905 - 126,694,866 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	126,672,651 - 126,698,616 (-)	NCBI
Celera	6	119,032,612 - 119,058,582 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

achondrogenesis type IA (ISO)

Experimental Liver Cirrhosis (ISO)

High Myopia (ISO)

lymphatic system disease (ISS)

Orthomyxoviridae Infections (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-trichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aconitine (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

curcumin (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

dioxygen (ISO)

dopamine (EXP)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

ethanol (ISO)

fenoldopam (EXP)

folic acid (ISO)

fonofos (ISO)

gentamycin (EXP)

imiquimod (ISO)

indometacin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenacetin (EXP)

phenylhydrazine (EXP)

rac-lactic acid (ISO)

resiquimod (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

Soman (EXP)

temozolomide (ISO)

terbufos (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triclosan (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity (ISO)

antigen processing and presentation of exogenous peptide antigen via MHC class II (IEA,ISO,ISS)

associative learning (IEA,ISO)

cellular response to amyloid-beta (IEA,ISO)

cellular response to calcium ion (IEA,ISO)

cellular response to hepatocyte growth factor stimulus (IEA,ISO)

dendritic spine organization (IEA,ISO)

memory (IEA,ISO)

negative regulation of ERBB signaling pathway (IEA,ISO,ISS)

negative regulation of gene expression (IEA,ISO)

negative regulation of multicellular organism growth (IEA,ISO)

negative regulation of neuron apoptotic process (IEA,ISO)

positive regulation of cell population proliferation (IEA,ISO)

positive regulation of endothelial cell chemotaxis (IEA,ISO)

positive regulation of long-term synaptic potentiation (IEA,ISO)

positive regulation of mitotic cell cycle (IEA,ISO)

positive regulation of monocyte chemotaxis (IEA,ISO)

protein maturation (IEA,ISO)

proteolysis (ISO,ISS)

proteolysis involved in protein catabolic process (IBA,IEA,ISO,ISS)

receptor catabolic process (IEA,ISO,ISS)

renal system process (IEA,ISO,ISS)

response to acidic pH (IEA,ISO)

self proteolysis (IEA,ISO)

vacuolar protein processing (IBA)

Cellular Component

apical part of cell (IEA,ISO)

cytoplasm (ISO)

extracellular region (IEA,ISO)

late endosome (IEA,ISO)

lysosomal lumen (IEA,ISO,ISS)

lysosome (IDA,ISO)

perinuclear region of cytoplasm (IEA,ISO)

Molecular Function

cysteine-type endopeptidase activity (IBA,IEA,IMP,ISO,ISS)

endopeptidase activator activity (IEA,ISO)

peptidase activity (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

antigen processing and presentation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and expression of mouse legumain, a lysosomal endopeptidase.	Chen JM, etal., Biochem J 1998 Oct 1;335 ( Pt 1):111-7.
2.	Cloning, isolation, and characterization of mammalian legumain, an asparaginyl endopeptidase.	Chen JM, etal., J Biol Chem. 1997 Mar 21;272(12):8090-8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Neuroprotective actions of PIKE-L by inhibition of SET proteolytic degradation by asparagine endopeptidase.	Liu Z, etal., Mol Cell. 2008 Mar 28;29(6):665-78. doi: 10.1016/j.molcel.2008.02.017.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:136644	PMID:9821970	PMID:12477932	PMID:12775715	PMID:17350006	PMID:18377911	PMID:20234379	PMID:21237226	PMID:21292981	PMID:21610319	PMID:22718532	PMID:23533145
PMID:25326800	PMID:30676070	PMID:31521890

Genomics

Comparative Map Data

Lgmn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	127,308,913 - 127,347,355 (-)	NCBI		GRCr8
mRatBN7.2	6	121,544,048 - 121,582,495 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	121,544,053 - 121,582,480 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	121,684,520 - 121,722,056 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	121,979,783 - 122,017,312 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	121,315,105 - 121,353,227 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	126,282,246 - 126,308,207 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	126,282,233 - 126,320,726 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	135,492,943 - 135,518,916 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	126,668,905 - 126,694,866 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	126,672,651 - 126,698,616 (-)	NCBI
Celera	6	119,032,612 - 119,058,582 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

LGMN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	92,703,809 - 92,748,627 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	92,703,807 - 92,748,679 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	93,170,154 - 93,214,972 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	92,239,907 - 92,284,765 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	92,239,909 - 92,284,765	NCBI
Celera	14	73,224,285 - 73,269,160 (-)	NCBI		Celera
Cytogenetic Map	14	q32.12	NCBI
HuRef	14	73,353,202 - 73,398,165 (-)	NCBI		HuRef
CHM1_1	14	93,108,397 - 93,153,238 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	86,935,604 - 86,980,392 (-)	NCBI		T2T-CHM13v2.0

Lgmn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	102,360,341 - 102,405,987 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	102,360,343 - 102,406,072 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	102,394,082 - 102,439,728 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	102,394,084 - 102,439,813 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	103,632,308 - 103,677,907 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	102,795,148 - 102,840,747 (-)	NCBI		MGSCv36	mm8
Celera	12	103,611,726 - 103,647,892 (-)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	51.45	NCBI

Lgmn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	14,905,856 - 14,939,256 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	14,905,856 - 14,938,722 (-)	NCBI	ChiLan1.0	ChiLan1.0

LGMN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	93,861,233 - 93,907,416 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	93,077,738 - 93,123,921 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	73,337,607 - 73,383,462 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	92,677,608 - 92,723,051 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	92,677,608 - 92,723,051 (-)	Ensembl	panpan1.1		panPan2

LGMN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	1,810,263 - 1,843,116 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	1,728,273 - 1,843,050 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	1,834,051 - 1,866,767 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	1,864,425 - 1,878,822 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	1,782,672 - 1,889,344 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	1,802,050 - 1,834,797 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	1,752,395 - 1,785,146 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	1,879,451 - 1,912,213 (-)	NCBI		UU_Cfam_GSD_1.0

Lgmn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	12,674,224 - 12,694,251 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936733	772,708 - 792,995 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936733	772,764 - 792,792 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LGMN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	114,173,693 - 114,217,102 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	114,176,217 - 114,210,096 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	120,780,926 - 120,811,668 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LGMN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	70,456,463 - 70,500,345 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	70,456,095 - 70,486,087 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	57,705,088 - 57,748,692 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lgmn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	9,204,790 - 9,240,309 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	9,207,496 - 9,240,026 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lgmn
306 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	198
Count of miRNA genes:	149
Interacting mature miRNAs:	160
Transcripts:	ENSRNOT00000010101
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

Markers in Region

D6Hmgc6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	121,570,409 - 121,570,760 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	126,308,599 - 126,308,949	NCBI	Rnor6.0
Rnor_5.0	6	135,519,308 - 135,519,658	UniSTS	Rnor5.0
Celera	6	119,058,974 - 119,059,323	UniSTS
Cytogenetic Map	6	q32	UniSTS

RH140587

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	121,546,683 - 121,546,892 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	126,284,877 - 126,285,085	NCBI	Rnor6.0
Rnor_5.0	6	135,495,574 - 135,495,782	UniSTS	Rnor5.0
RGSC_v3.4	6	126,671,536 - 126,671,744	UniSTS	RGSC3.4
Celera	6	119,035,243 - 119,035,451	UniSTS
RH 3.4 Map	6	852.2	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB032766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC135150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF154349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087708	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010101 ⟹ ENSRNOP00000010101

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	121,544,053 - 121,582,480 (-)	Ensembl
Rnor_6.0 Ensembl	6	126,282,233 - 126,320,726 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103783 ⟹ ENSRNOP00000084412

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	121,544,053 - 121,582,480 (-)	Ensembl

RefSeq Acc Id:

NM_022226 ⟹ NP_071562

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	127,308,913 - 127,347,328 (-)	NCBI
mRatBN7.2	6	121,544,048 - 121,582,468 (-)	NCBI
Rnor_6.0	6	126,282,246 - 126,308,207 (-)	NCBI
Rnor_5.0	6	135,492,943 - 135,518,916 (-)	NCBI
RGSC_v3.4	6	126,668,905 - 126,694,866 (-)	RGD
Celera	6	119,032,612 - 119,058,582 (-)	RGD

Sequence:

show sequence

CGGCGAACACCCGCCCAGTCTTCTGAAGCGGACACTGTGGGTGCAGAATGATCTGGAAAGTGGC
TGTGCTTCTCAGCCTAGTGCTGGGTGCTGGTGCTGTTCACATCGGTGTGGATGACCCTGAGGAC
GGTGGCAAGCACTGGGTGGTGATTGTGGCGGGCTCCAATGGCTGGTATAATTACCGACACCAGG
CAGACGCATGCCACGCCTACCAGATCATCCACCGGAACGGGATTCCTGACGAGCAGATCATAGT
GATGATGTATGACGACATCGCCAACAATGAAGAAAACCCGACTCCAGGTGTTGTGATCAACCGA
CCTAACGGCACAGACGTGTACAAGGGAGTCCCGAAGGACTACACTGGAGAGGATGTGACTCCAG
AGAATTTCCTCGCAGTGCTGAGAGGCGACGAAGAAGCTGTGAAGGGCAAAGGGTCCGGAAAAGT
CTTGAAGAGTGGGCCCCGGGATCATGTATTTGTTTACTTCACCGACCACGGAGCCACTGGAATC
CTGGTGTTTCCTAACGAAGATCTTCATGTCAAGGACCTGAATAAGACTATTCGCTACATGTATG
AGCACAAAATGTACCAGAAGATGGTGTTTTACATTGAAGCATGTGAGTCCGGCTCCATGATGAA
CCACCTGCCCGATGACATCGATGTTTATGCAACCACTGCCGCCAACCCCAACGAGTCATCTTAC
GCCTGCTACTATGACGAGGAGAGGAGCACTTACCTGGGTGACTGGTACAGCGTCAACTGGATGG
AAGATTCCGATGTGGAGGATCTGACCAAAGAGACACTTCACAAGCAGTACCACCTGGTCAAGTC
CCACACCAACACCAGTCACGTCATGCAGTATGGGAACAAATCTATCTCTACCATGAAAGTGATG
CAGTTTCAAGGAATGAAGCACAGAGCCAGTTCACCCATCTCGCTGCCTCCAGTCACACACCTTG
ACCTCACCCCCAGCCCTGACGTGCCCCTGACCATCCTGAAAAGGAAGCTGCTGAGAACCAACAA
CATGAAGGAATCCCAAGTTCTCGTCGGGCAGATCCAGCACCTTCTGGATGCCAGGCACATCATT
GAGAAGTCTGTGCAAAAGATCGTTTCCCTGCTGGCAGGATTTGGGGAAACTGCTCAGAAACATC
TGTCAGAGAGAGCCATGCTCACAGCACATGACTGCCATCAGGAGGCCGTGACCCACTTCCGCAC
ACACTGCTTTAACTGGCACTCAGTCACGTACGAGCATGCCTTGCGGTATTTGTACGTGCTGGCC
AACCTCTGTGAGAAGCCATATCCGATTGACAGGATAAAGATGGCCATGGACAAAGTGTGCCTTA
GTCACTACTGAACAGCTCTCTTCCCAGTGCTTCTAGAAGAGTGAGCACAGTACACTGGAATGTG
AACCAACCGGAGTGAACCAAGCGGAGACCGGAAGGGCGGAGTCAGAGGCAGCACCTAAGCCCCG
CCCCCAGGGATACCGTCCGCCCACCCCAGGGCTTGCTTTCTGAGGATACCTGCTTACTAAGAAG
CCAGTTTGGGTCTGGAGGAAGGAACTTTTGCTTCTTAGGAATTTTTGGGTTTGTTTTGTTGTCC
ATTAGCTTTCAAGAGCAGATTCACTGCGGATTCTGTAGCCAGTGAAGGAACCGGAGAAATTCTC
GAAGCTGAAACCTCTTGTCGCCTTCACAGTGATTTTACCGAAGAGGGCAAAAGCAAGTCCCTAC
TGGAGAATTATTTTTAGAATATATAATTTTTGATCGCTTTTATATTTTATTCTGTAATAATGGA
TGTCCTAAAACAAATAAGTGAAGTGAGACATTTGTTCCTGGAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039112870 ⟹ XP_038968798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	127,308,918 - 127,347,355 (-)	NCBI
mRatBN7.2	6	121,544,053 - 121,582,495 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071562	(Get FASTA)	NCBI Sequence Viewer
	XP_038968798	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF73260	(Get FASTA)	NCBI Sequence Viewer
	AAH87708	(Get FASTA)	NCBI Sequence Viewer
	BAA84750	(Get FASTA)	NCBI Sequence Viewer
	EDL81744	(Get FASTA)	NCBI Sequence Viewer
	EDL81745	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010101.3
	ENSRNOP00000084412.1
GenBank Protein	Q9R0J8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071562 ⟸ NM_022226
- Peptide Label:	precursor
- UniProtKB:	Q9R0J8 (UniProtKB/Swiss-Prot), Q9JLN3 (UniProtKB/Swiss-Prot), Q5PPG2 (UniProtKB/TrEMBL), A6JEK1 (UniProtKB/TrEMBL), F7EX67 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIWKVAVLLSLVLGAGAVHIGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIP DEQIIVMMYDDIANNEENPTPGVVINRPNGTDVYKGVPKDYTGEDVTPENFLAVLRGDEEAVKG KGSGKVLKSGPRDHVFVYFTDHGATGILVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEACE SGSMMNHLPDDIDVYATTAANPNESSYACYYDEERSTYLGDWYSVNWMEDSDVEDLTKETLHKQ YHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRK LLRTNNMKESQVLVGQIQHLLDARHIIEKSVQKIVSLLAGFGETAQKHLSERAMLTAHDCHQEA VTHFRTHCFNWHSVTYEHALRYLYVLANLCEKPYPIDRIKMAMDKVCLSHY hide sequence

Ensembl Acc Id:

ENSRNOP00000010101 ⟸ ENSRNOT00000010101

RefSeq Acc Id:	XP_038968798 ⟸ XM_039112870
- Peptide Label:	isoform X1
- UniProtKB:	Q9R0J8 (UniProtKB/Swiss-Prot), Q9JLN3 (UniProtKB/Swiss-Prot), Q5PPG2 (UniProtKB/TrEMBL), A6JEK1 (UniProtKB/TrEMBL), F7EX67 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084412 ⟸ ENSRNOT00000103783

Protein Domains

Legumain prodomain

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9R0J8-F1-model_v2	AlphaFold	Q9R0J8	1-435	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619832	AgrOrtholog
BioCyc Gene	G2FUF-36453	BioCyc
Ensembl Genes	ENSRNOG00000007089	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010101.6	UniProtKB/TrEMBL
	ENSRNOT00000103783.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.132.130	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.1460	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7315308	IMAGE-MGC_LOAD
InterPro	IPR043577	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Legum_prodom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Legumain_prodom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C13	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:63865	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105274	IMAGE-MGC_LOAD
NCBI Gene	63865	ENTREZGENE
PANTHER	LEGUMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12000	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Legum_prodom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C13	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Lgmn	PhenoGen
PIRSF	Legumain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PIRSF500139	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	HEMOGLOBNASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007089	RatGTEx
UniProt	A0A8I6A185_RAT	UniProtKB/TrEMBL
	A6JEK0_RAT	UniProtKB/TrEMBL
	A6JEK1	ENTREZGENE, UniProtKB/TrEMBL
	F7EX67	ENTREZGENE, UniProtKB/TrEMBL
	LGMN_RAT	UniProtKB/Swiss-Prot
	Q5PPG2	ENTREZGENE
	Q9JLN3	ENTREZGENE
	Q9R0J8	ENTREZGENE
UniProt Secondary	Q5PPG2	UniProtKB/TrEMBL
	Q9JLN3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-04-22	Lgmn	legumain	Prsc1	protease, cysteine, 1 (legumain)	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	Prsc1	protease, cysteine, 1 (legumain)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)