Symbol:
Lgmn
Name:
legumain
RGD ID:
619832
Description:
Enables cysteine-type endopeptidase activity. Predicted to be involved in several processes, including learning or memory; positive regulation of chemotaxis; and proteolysis. Predicted to act upstream of or within negative regulation of neuron apoptotic process; regulation of growth; and response to acidic pH. Located in lysosome. Orthologous to human LGMN (legumain); PARTICIPATES IN antigen processing and presentation pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
asparaginyl endopeptidase; MGC105274; protease, cysteine 1; protease, cysteine, 1 (legumain); Prsc1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LGMN (legumain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lgmn (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lgmn (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LGMN (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LGMN (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lgmn (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LGMN (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LGMN (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lgmn (legumain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
LGMN (legumain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Lgmn (legumain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lgmn (legumain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T28H10.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lgmn
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 127,308,913 - 127,347,355 (-) NCBI GRCr8 mRatBN7.2 6 121,544,048 - 121,582,495 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 121,544,053 - 121,582,480 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 121,684,520 - 121,722,056 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 121,979,783 - 122,017,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 121,315,105 - 121,353,227 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 126,282,246 - 126,308,207 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 126,282,233 - 126,320,726 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 135,492,943 - 135,518,916 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 126,668,905 - 126,694,866 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 126,672,651 - 126,698,616 (-) NCBI Celera 6 119,032,612 - 119,058,582 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lgmn Rat (1->4)-beta-D-glucan multiple interactions ISO Lgmn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of LGMN mRNA CTD PMID:36331819 Lgmn Rat 1,1,1-trichloroethane increases expression ISO Lgmn (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Lgmn Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of LGMN mRNA CTD PMID:25380136 Lgmn Rat 17beta-estradiol affects expression ISO Lgmn (Mus musculus) 6480464 Estradiol affects the expression of LGMN mRNA CTD PMID:15598610 Lgmn Rat 17beta-estradiol increases expression ISO Lgmn (Mus musculus) 6480464 Estradiol results in increased expression of LGMN mRNA CTD PMID:19484750 Lgmn Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO LGMN (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Lgmn Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO LGMN (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Lgmn Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Lgmn (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Lgmn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LGMN mRNA CTD PMID:21215274 and PMID:33387578 Lgmn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LGMN mRNA CTD PMID:34747641 Lgmn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO LGMN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of LGMN mRNA CTD PMID:23152189 Lgmn Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Lgmn (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of LGMN mRNA CTD PMID:18200517 Lgmn Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Lgmn (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of LGMN mRNA] CTD PMID:18200517 Lgmn Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Lgmn (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Lgmn Rat 2-hydroxypropanoic acid decreases expression ISO LGMN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LGMN mRNA CTD PMID:30851411 Lgmn Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Lgmn Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of LGMN mRNA CTD PMID:28300664 Lgmn Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO LGMN (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of LGMN protein CTD PMID:31675489 Lgmn Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO LGMN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of LGMN mRNA CTD PMID:28628672 Lgmn Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of LGMN mRNA CTD PMID:25380136 Lgmn Rat 4,4'-sulfonyldiphenol decreases expression ISO Lgmn (Mus musculus) 6480464 bisphenol S results in decreased expression of LGMN mRNA CTD PMID:39298647 Lgmn Rat 4,4'-sulfonyldiphenol increases expression ISO LGMN (Homo sapiens) 6480464 bisphenol S results in increased expression of LGMN protein CTD PMID:34186270 Lgmn Rat 4,4'-sulfonyldiphenol decreases methylation ISO LGMN (Homo sapiens) 6480464 bisphenol S results in decreased methylation of LGMN gene CTD PMID:31601247 Lgmn Rat 4-hydroxyphenyl retinamide decreases expression ISO Lgmn (Mus musculus) 6480464 Fenretinide results in decreased expression of LGMN mRNA CTD PMID:28973697 Lgmn Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of LGMN mRNA CTD PMID:31881176 Lgmn Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of LGMN protein CTD PMID:33236894 Lgmn Rat acrolein multiple interactions ISO LGMN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LGMN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LGMN mRNA CTD PMID:32699268 Lgmn Rat acrylamide increases expression ISO LGMN (Homo sapiens) 6480464 Acrylamide results in increased expression of LGMN mRNA CTD PMID:32763439 Lgmn Rat aflatoxin B1 increases methylation ISO LGMN (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of LGMN intron CTD PMID:30157460 Lgmn Rat all-trans-retinoic acid increases expression ISO Lgmn (Mus musculus) 6480464 Tretinoin results in increased expression of LGMN mRNA CTD PMID:16236135 Lgmn Rat alpha-pinene multiple interactions ISO LGMN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LGMN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of LGMN mRNA CTD PMID:32699268 Lgmn Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LGMN mRNA CTD PMID:16483693 Lgmn Rat aristolochic acid A increases expression ISO LGMN (Homo sapiens) 6480464 aristolochic acid I results in increased expression of LGMN mRNA CTD PMID:33212167 Lgmn Rat arsenous acid decreases expression ISO LGMN (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LGMN mRNA CTD PMID:15725085 Lgmn Rat benzo[a]pyrene decreases expression ISO Lgmn (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of LGMN mRNA CTD PMID:19770486 Lgmn Rat benzo[a]pyrene affects methylation ISO LGMN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LGMN promoter CTD PMID:27901495 Lgmn Rat benzo[a]pyrene diol epoxide I increases expression ISO LGMN (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Lgmn Rat beta-naphthoflavone decreases expression ISO LGMN (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of LGMN mRNA CTD PMID:32858204 Lgmn Rat bis(2-ethylhexyl) phthalate decreases expression ISO Lgmn (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of LGMN mRNA CTD PMID:34319233 Lgmn Rat bis(2-ethylhexyl) phthalate increases expression ISO Lgmn (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LGMN mRNA CTD PMID:33754040 Lgmn Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LGMN mRNA CTD PMID:25181051 Lgmn Rat bisphenol A decreases expression ISO Lgmn (Mus musculus) 6480464 bisphenol A results in decreased expression of LGMN mRNA CTD PMID:32156529 Lgmn Rat bisphenol A increases expression ISO LGMN (Homo sapiens) 6480464 bisphenol A results in increased expression of LGMN protein CTD PMID:34186270 Lgmn Rat bisphenol A increases methylation ISO LGMN (Homo sapiens) 6480464 bisphenol A results in increased methylation of LGMN gene CTD PMID:31601247 Lgmn Rat bisphenol A decreases expression ISO LGMN (Homo sapiens) 6480464 bisphenol A results in decreased expression of LGMN protein CTD PMID:31675489 Lgmn Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LGMN mRNA CTD PMID:34947998 Lgmn Rat bisphenol A increases expression ISO Lgmn (Mus musculus) 6480464 bisphenol A results in increased expression of LGMN mRNA CTD PMID:34585602 Lgmn Rat bisphenol A decreases methylation ISO Lgmn (Mus musculus) 6480464 bisphenol A results in decreased methylation of LGMN promoter CTD PMID:27312807 Lgmn Rat bisphenol AF increases expression ISO LGMN (Homo sapiens) 6480464 bisphenol AF results in increased expression of LGMN protein CTD PMID:34186270 Lgmn Rat bisphenol F multiple interactions ISO LGMN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of LGMN mRNA CTD PMID:28628672 Lgmn Rat bisphenol F increases expression ISO LGMN (Homo sapiens) 6480464 bisphenol F results in increased expression of LGMN protein CTD PMID:34186270 Lgmn Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of LGMN mRNA CTD PMID:24136188 Lgmn Rat cadmium dichloride decreases expression ISO LGMN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of LGMN protein CTD PMID:24527689 Lgmn Rat cadmium dichloride increases expression ISO LGMN (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of LGMN mRNA CTD PMID:38568856 Lgmn Rat carbon nanotube increases expression ISO Lgmn (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Lgmn Rat carnosic acid decreases expression ISO Lgmn (Mus musculus) 6480464 salvin results in decreased expression of LGMN protein CTD PMID:35926579 Lgmn Rat choline multiple interactions ISO Lgmn (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGMN mRNA CTD PMID:20938992 Lgmn Rat cisplatin multiple interactions ISO LGMN (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of LGMN mRNA CTD PMID:27392435 Lgmn Rat cobalt dichloride increases expression ISO LGMN (Homo sapiens) 6480464 cobaltous chloride results in increased expression of LGMN mRNA CTD PMID:19320972 and PMID:22941251 Lgmn Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of LGMN mRNA CTD PMID:30556269 Lgmn Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of LGMN mRNA CTD PMID:30556269 Lgmn Rat curcumin multiple interactions ISO Lgmn (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of LGMN mRNA] CTD PMID:18200517 Lgmn Rat decabromodiphenyl ether decreases expression ISO LGMN (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of LGMN protein CTD PMID:31675489 Lgmn Rat deguelin decreases expression ISO LGMN (Homo sapiens) 6480464 deguelin results in decreased expression of LGMN mRNA CTD PMID:33512557 Lgmn Rat dexamethasone multiple interactions ISO LGMN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of LGMN mRNA CTD PMID:28628672 Lgmn Rat dextran sulfate multiple interactions ISO Lgmn (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of LGMN protein] CTD PMID:35362542 Lgmn Rat dextran sulfate decreases expression ISO Lgmn (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of LGMN protein CTD PMID:35362542 Lgmn Rat diarsenic trioxide decreases expression ISO LGMN (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of LGMN mRNA CTD PMID:15725085 Lgmn Rat dibutyl phthalate increases expression ISO Lgmn (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of LGMN mRNA CTD PMID:17361019 and PMID:21266533 Lgmn Rat diclofenac increases expression ISO Lgmn (Mus musculus) 6480464 Diclofenac results in increased expression of LGMN mRNA CTD PMID:26934552 Lgmn Rat dioxygen multiple interactions ISO Lgmn (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of LGMN mRNA CTD PMID:30529165 Lgmn Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of LGMN mRNA CTD PMID:21983523 Lgmn Rat doxorubicin increases expression ISO Lgmn (Mus musculus) 6480464 Doxorubicin results in increased expression of LGMN protein CTD PMID:30517846 Lgmn Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of LGMN mRNA CTD PMID:29391264 Lgmn Rat enzyme inhibitor multiple interactions ISO LGMN (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of LGMN protein CTD PMID:23301498 Lgmn Rat ethanol multiple interactions ISO Lgmn (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of LGMN mRNA CTD PMID:30319688 Lgmn Rat Evodiamine multiple interactions ISO Lgmn (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of LGMN protein] CTD PMID:35362542 Lgmn Rat fenoldopam increases expression EXP 6480464 Fenoldopam results in increased expression of LGMN mRNA CTD PMID:21983523 Lgmn Rat folic acid multiple interactions ISO Lgmn (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGMN mRNA CTD PMID:20938992 Lgmn Rat fonofos increases methylation ISO LGMN (Homo sapiens) 6480464 Fonofos results in increased methylation of LGMN promoter CTD PMID:22847954 Lgmn Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of LGMN mRNA CTD PMID:33387578 Lgmn Rat imiquimod increases activity ISO Lgmn (Mus musculus) 6480464 Imiquimod results in increased activity of LGMN protein CTD PMID:22916010 Lgmn Rat imiquimod multiple interactions ISO Lgmn (Mus musculus) 6480464 LGMN gene mutant form inhibits the reaction [Imiquimod results in increased cleavage of TLR7 protein] more ... CTD PMID:22916010 Lgmn Rat indometacin multiple interactions ISO LGMN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of LGMN mRNA CTD PMID:28628672 Lgmn Rat ivermectin decreases expression ISO LGMN (Homo sapiens) 6480464 Ivermectin results in decreased expression of LGMN protein CTD PMID:32959892 Lgmn Rat L-methionine multiple interactions ISO Lgmn (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of LGMN mRNA CTD PMID:20938992 Lgmn Rat lipopolysaccharide increases expression ISO Lgmn (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of LGMN mRNA CTD PMID:27339419 Lgmn Rat lipopolysaccharide increases expression ISO LGMN (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of LGMN mRNA CTD PMID:35811015 Lgmn Rat lipopolysaccharide multiple interactions ISO LGMN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of LGMN mRNA CTD PMID:35811015 Lgmn Rat mono(2-ethylhexyl) phthalate decreases expression ISO Lgmn (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of LGMN mRNA CTD PMID:22401849 Lgmn Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of LGMN mRNA CTD PMID:19638242 Lgmn Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of LGMN mRNA CTD PMID:28943392 Lgmn Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of LGMN mRNA CTD PMID:25380136 Lgmn Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of LGMN mRNA CTD PMID:24136188 Lgmn Rat nitrogen dioxide multiple interactions ISO LGMN (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of [Particulate Matter co-treated with Nitrogen Dioxide]] which results in increased expression of LGMN mRNA CTD PMID:35091019 Lgmn Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LGMN mRNA CTD PMID:25729387 Lgmn Rat ozone multiple interactions ISO LGMN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of LGMN mRNA more ... CTD PMID:32699268 Lgmn Rat paracetamol affects expression ISO Lgmn (Mus musculus) 6480464 Acetaminophen affects the expression of LGMN mRNA CTD PMID:17562736 Lgmn Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of LGMN mRNA CTD PMID:33387578 Lgmn Rat paracetamol affects expression ISO LGMN (Homo sapiens) 6480464 Acetaminophen affects the expression of LGMN mRNA CTD PMID:25458485 Lgmn Rat paracetamol increases expression ISO LGMN (Homo sapiens) 6480464 Acetaminophen results in increased expression of LGMN mRNA CTD PMID:22230336 and PMID:29067470 Lgmn Rat parathion increases methylation ISO LGMN (Homo sapiens) 6480464 Parathion results in increased methylation of LGMN promoter CTD PMID:22847954 Lgmn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Lgmn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of LGMN mRNA CTD PMID:36331819 Lgmn Rat phenacetin increases expression EXP 6480464 Phenacetin results in increased expression of LGMN mRNA CTD PMID:17698508 Lgmn Rat phenylhydrazine increases expression EXP 6480464 phenylhydrazine results in increased expression of LGMN mRNA CTD PMID:17698508 Lgmn Rat rac-lactic acid decreases expression ISO LGMN (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LGMN mRNA CTD PMID:30851411 Lgmn Rat resiquimod multiple interactions ISO Lgmn (Mus musculus) 6480464 LGMN gene mutant form inhibits the reaction [resiquimod results in increased secretion of IL6 protein] and LGMN gene mutant form inhibits the reaction [resiquimod results in increased secretion of TNF protein] CTD PMID:22916010 Lgmn Rat rotenone decreases expression ISO Lgmn (Mus musculus) 6480464 Rotenone results in decreased expression of LGMN mRNA CTD PMID:23186747 Lgmn Rat rotenone decreases expression ISO LGMN (Homo sapiens) 6480464 Rotenone results in decreased expression of LGMN mRNA CTD PMID:33512557 Lgmn Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LGMN mRNA CTD PMID:28374803 Lgmn Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO LGMN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of LGMN mRNA CTD PMID:35811015 Lgmn Rat silicon dioxide decreases expression ISO LGMN (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of LGMN mRNA CTD PMID:25895662 Lgmn Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of LGMN mRNA CTD PMID:22431001 Lgmn Rat sodium arsenite increases expression ISO LGMN (Homo sapiens) 6480464 sodium arsenite results in increased expression of LGMN mRNA CTD PMID:38568856 Lgmn Rat sodium arsenite decreases expression ISO Lgmn (Mus musculus) 6480464 sodium arsenite results in decreased expression of LGMN mRNA CTD PMID:37682722 Lgmn Rat sodium dichromate decreases expression ISO LGMN (Homo sapiens) 6480464 sodium bichromate results in decreased expression of LGMN mRNA CTD PMID:17685462 Lgmn Rat Soman increases expression EXP 6480464 Soman results in increased expression of LGMN mRNA CTD PMID:19281266 Lgmn Rat temozolomide increases expression ISO LGMN (Homo sapiens) 6480464 Temozolomide results in increased expression of LGMN mRNA CTD PMID:31758290 Lgmn Rat terbufos increases methylation ISO LGMN (Homo sapiens) 6480464 terbufos results in increased methylation of LGMN promoter CTD PMID:22847954 Lgmn Rat tetrachloromethane increases expression ISO Lgmn (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of LGMN mRNA CTD PMID:27339419 and PMID:31919559 Lgmn Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of LGMN mRNA CTD PMID:28943392 Lgmn Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LGMN mRNA CTD PMID:34492290 Lgmn Rat thiram increases expression ISO LGMN (Homo sapiens) 6480464 Thiram results in increased expression of LGMN mRNA CTD PMID:38568856 Lgmn Rat titanium dioxide increases expression ISO Lgmn (Mus musculus) 6480464 titanium dioxide results in increased expression of LGMN mRNA CTD PMID:23131501 and PMID:23557971 Lgmn Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LGMN mRNA CTD PMID:25729387 Lgmn Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of LGMN mRNA CTD PMID:25729387 Lgmn Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of LGMN mRNA CTD PMID:33387578 Lgmn Rat triclosan decreases expression ISO LGMN (Homo sapiens) 6480464 Triclosan results in decreased expression of LGMN mRNA CTD PMID:30510588 Lgmn Rat urethane increases expression ISO LGMN (Homo sapiens) 6480464 Urethane results in increased expression of LGMN mRNA CTD PMID:28818685 Lgmn Rat valproic acid affects expression ISO LGMN (Homo sapiens) 6480464 Valproic Acid affects the expression of LGMN mRNA CTD PMID:25979313 Lgmn Rat valproic acid increases expression ISO LGMN (Homo sapiens) 6480464 Valproic Acid results in increased expression of LGMN mRNA CTD PMID:23179753 more ...
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-trichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (EXP) aconitine (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) buspirone (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) carnosic acid (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) curcumin (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dioxygen (ISO) dopamine (EXP) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) Evodiamine (ISO) fenoldopam (EXP) folic acid (ISO) fonofos (ISO) gentamycin (EXP) imiquimod (ISO) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nimesulide (EXP) nitrogen dioxide (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenacetin (EXP) phenylhydrazine (EXP) rac-lactic acid (ISO) resiquimod (ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) temozolomide (ISO) terbufos (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triclosan (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
antigen processing and presentation of exogenous peptide antigen via MHC class I (ISO) antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent (ISO) antigen processing and presentation of exogenous peptide antigen via MHC class II (IEA,ISO,ISS) associative learning (IEA,ISO) cellular response to amyloid-beta (IEA,ISO) cellular response to calcium ion (IEA,ISO) cellular response to hepatocyte growth factor stimulus (IEA,ISO) dendritic spine organization (IEA,ISO) memory (IEA,ISO) negative regulation of ERBB signaling pathway (IEA,ISO,ISS) negative regulation of gene expression (IEA,ISO) negative regulation of multicellular organism growth (IEA,ISO) negative regulation of neuron apoptotic process (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of endothelial cell chemotaxis (IEA,ISO) positive regulation of long-term synaptic potentiation (IEA,ISO) positive regulation of mitotic cell cycle (IEA,ISO) positive regulation of monocyte chemotaxis (IEA,ISO) protein maturation (IEA,ISO) proteolysis (IEA,ISO,ISS) proteolysis involved in protein catabolic process (IBA,IEA,ISO,ISS) receptor catabolic process (IEA,ISO,ISS) renal system process (IEA,ISO,ISS) response to acidic pH (IEA,ISO) vacuolar protein processing (IBA)
1.
Cloning and expression of mouse legumain, a lysosomal endopeptidase.
Chen JM, etal., Biochem J 1998 Oct 1;335 ( Pt 1):111-7.
2.
Cloning, isolation, and characterization of mammalian legumain, an asparaginyl endopeptidase.
Chen JM, etal., J Biol Chem. 1997 Mar 21;272(12):8090-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Neuroprotective actions of PIKE-L by inhibition of SET proteolytic degradation by asparagine endopeptidase.
Liu Z, etal., Mol Cell. 2008 Mar 28;29(6):665-78. doi: 10.1016/j.molcel.2008.02.017.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Lgmn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 127,308,913 - 127,347,355 (-) NCBI GRCr8 mRatBN7.2 6 121,544,048 - 121,582,495 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 121,544,053 - 121,582,480 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 121,684,520 - 121,722,056 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 121,979,783 - 122,017,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 121,315,105 - 121,353,227 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 126,282,246 - 126,308,207 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 126,282,233 - 126,320,726 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 135,492,943 - 135,518,916 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 126,668,905 - 126,694,866 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 126,672,651 - 126,698,616 (-) NCBI Celera 6 119,032,612 - 119,058,582 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
LGMN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 92,703,809 - 92,748,627 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 92,703,807 - 92,748,679 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 93,170,154 - 93,214,972 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 92,239,907 - 92,284,765 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 92,239,909 - 92,284,765 NCBI Celera 14 73,224,285 - 73,269,160 (-) NCBI Celera Cytogenetic Map 14 q32.12 NCBI HuRef 14 73,353,202 - 73,398,165 (-) NCBI HuRef CHM1_1 14 93,108,397 - 93,153,238 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 86,935,604 - 86,980,392 (-) NCBI T2T-CHM13v2.0
Lgmn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 102,360,341 - 102,405,987 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 102,360,343 - 102,406,072 (-) Ensembl GRCm39 Ensembl GRCm38 12 102,394,082 - 102,439,728 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 102,394,084 - 102,439,813 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 103,632,308 - 103,677,907 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 102,795,148 - 102,840,747 (-) NCBI MGSCv36 mm8 Celera 12 103,611,726 - 103,647,892 (-) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 51.45 NCBI
Lgmn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 14,905,856 - 14,939,256 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 14,905,856 - 14,938,722 (-) NCBI ChiLan1.0 ChiLan1.0
LGMN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 93,861,233 - 93,907,416 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 93,077,738 - 93,123,921 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 73,337,607 - 73,383,462 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 92,677,608 - 92,723,051 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 92,677,608 - 92,723,051 (-) Ensembl panpan1.1 panPan2
LGMN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 1,810,263 - 1,843,116 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 1,728,273 - 1,843,050 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 1,834,051 - 1,866,767 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 1,864,425 - 1,878,822 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 1,782,672 - 1,889,344 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 1,802,050 - 1,834,797 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 1,752,395 - 1,785,146 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 1,879,451 - 1,912,213 (-) NCBI UU_Cfam_GSD_1.0
Lgmn
LGMN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 114,173,693 - 114,217,102 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 114,176,217 - 114,210,096 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 120,780,926 - 120,811,668 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LGMN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 70,456,463 - 70,500,345 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 70,456,095 - 70,486,087 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 57,705,088 - 57,748,692 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lgmn
.
Predicted Target Of
Count of predictions: 198 Count of miRNA genes: 149 Interacting mature miRNAs: 160 Transcripts: ENSRNOT00000010101 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
D6Hmgc6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 127,335,269 - 127,335,620 (+) Marker Load Pipeline mRatBN7.2 6 121,570,409 - 121,570,760 (+) MAPPER mRatBN7.2 Rnor_6.0 6 126,308,599 - 126,308,949 NCBI Rnor6.0 Rnor_5.0 6 135,519,308 - 135,519,658 UniSTS Rnor5.0 Celera 6 119,058,974 - 119,059,323 UniSTS Cytogenetic Map 6 q32 UniSTS
RH140587
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 121,546,683 - 121,546,892 (+) MAPPER mRatBN7.2 Rnor_6.0 6 126,284,877 - 126,285,085 NCBI Rnor6.0 Rnor_5.0 6 135,495,574 - 135,495,782 UniSTS Rnor5.0 RGSC_v3.4 6 126,671,536 - 126,671,744 UniSTS RGSC3.4 Celera 6 119,035,243 - 119,035,451 UniSTS RH 3.4 Map 6 852.2 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010101 ⟹ ENSRNOP00000010101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 121,544,053 - 121,582,480 (-) Ensembl Rnor_6.0 Ensembl 6 126,282,233 - 126,320,726 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103783 ⟹ ENSRNOP00000084412
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 121,544,053 - 121,582,480 (-) Ensembl
RefSeq Acc Id:
NM_022226 ⟹ NP_071562
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 127,308,913 - 127,347,328 (-) NCBI mRatBN7.2 6 121,544,048 - 121,582,468 (-) NCBI Rnor_6.0 6 126,282,246 - 126,308,207 (-) NCBI Rnor_5.0 6 135,492,943 - 135,518,916 (-) NCBI RGSC_v3.4 6 126,668,905 - 126,694,866 (-) RGD Celera 6 119,032,612 - 119,058,582 (-) RGD
Sequence:
CGGCGAACACCCGCCCAGTCTTCTGAAGCGGACACTGTGGGTGCAGAATGATCTGGAAAGTGGCTGTGCTTCTCAGCCTAGTGCTGGGTGCTGGTGCTGTTCACATCGGTGTGGATGACCCTGAGGAC
hide sequence
RefSeq Acc Id:
XM_039112870 ⟹ XP_038968798
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 127,308,918 - 127,347,355 (-) NCBI mRatBN7.2 6 121,544,053 - 121,582,495 (-) NCBI
RefSeq Acc Id:
NP_071562 ⟸ NM_022226
- Peptide Label:
precursor
- UniProtKB:
Q9R0J8 (UniProtKB/Swiss-Prot), Q9JLN3 (UniProtKB/Swiss-Prot), Q5PPG2 (UniProtKB/TrEMBL), A6JEK1 (UniProtKB/TrEMBL), F7EX67 (UniProtKB/TrEMBL)
- Sequence:
MIWKVAVLLSLVLGAGAVHIGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANNEENPTPGVVINRPNGTDVYKGVPKDYTGEDVTPENFLAVLRGDEEAVKG
hide sequence
Ensembl Acc Id:
ENSRNOP00000010101 ⟸ ENSRNOT00000010101
RefSeq Acc Id:
XP_038968798 ⟸ XM_039112870
- Peptide Label:
isoform X1
- UniProtKB:
Q9R0J8 (UniProtKB/Swiss-Prot), Q9JLN3 (UniProtKB/Swiss-Prot), Q5PPG2 (UniProtKB/TrEMBL), A6JEK1 (UniProtKB/TrEMBL), F7EX67 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000084412 ⟸ ENSRNOT00000103783
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-04-22
Lgmn
legumain
Prsc1
protease, cysteine, 1 (legumain)
Symbol and Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
2002-08-07
Prsc1
protease, cysteine, 1 (legumain)
Symbol and Name status set to provisional
70820 PROVISIONAL
