Advanced Search (OLGA)

Gene: Pou3f3 (POU class 3 homeobox 3) Rattus norvegicus

Analyze

Symbol:

Pou3f3

Name:

POU class 3 homeobox 3

RGD ID:

619768

Description:

Enables DNA-binding transcription factor activity, RNA polymerase II-specific. Involved in positive regulation of gene expression and positive regulation of transcription by RNA polymerase II. Acts upstream of or within negative regulation of transcription by RNA polymerase II. Located in nucleus. Orthologous to human POU3F3 (POU class 3 homeobox 3); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

brain-1; brain-specific homeobox/POU domain protein 1; brn-1 protein; Brn1; class III POU protein POU-domain; POU domain, class 3, transcription factor 3; RHS1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU3F3 (POU class 3 homeobox 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pou3f3 (POU domain, class 3, transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU3F3 (POU class 3 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU3F3 (POU class 3 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU3F3 (POU class 3 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103241369 (uncharacterized LOC103241369)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou3f3 (POU class 3 homeobox 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AMPD3 (adenosine monophosphate deaminase 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POU3F3 (POU class 3 homeobox 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pou3f3 (POU domain, class 3, transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou3f3b (POU class 3 homeobox 3b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou3f3a (POU class 3 homeobox 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YOX1	Alliance	DIOPT (Hieranoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	ceh-6	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vvl	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pou3f3	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	52,438,026 - 52,441,152 (+)	NCBI		GRCr8
mRatBN7.2	9	44,945,872 - 44,948,998 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	44,945,872 - 44,948,992 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	53,439,603 - 53,442,731 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	58,562,401 - 58,565,529 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	56,843,728 - 56,846,854 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	49,479,148 - 49,482,246 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	49,479,023 - 49,482,252 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	49,152,036 - 49,154,632 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	41,873,891 - 41,876,408 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	41,875,036 - 41,877,823 (+)	NCBI
Celera	9	42,631,024 - 42,668,104 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

Neurodevelopmental Disorders (ISO)

osteoarthritis (ISO)

Snijders Blok-Fisher Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

Aroclor 1254 (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

chlordecone (ISO)

cisplatin (EXP)

clofibric acid (EXP)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

diethylstilbestrol (EXP)

enzyme inhibitor (ISO)

ethanol (ISO)

gentamycin (EXP)

lead nitrate (ISO)

maneb (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (ISO)

pinostrobin (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cerebral cortex radially oriented cell migration (IEA,ISO)

chemical homeostasis (IEA,ISO)

forebrain ventricular zone progenitor cell division (IEA,ISO)

kidney development (ISO)

metanephric ascending thin limb development (IEA,ISO,ISS)

metanephric DCT cell differentiation (IEA,ISO,ISS)

metanephric loop of Henle development (ISO,ISS)

metanephric macula densa development (IEA,ISO,ISS)

metanephric thick ascending limb development (IEA,ISO,ISS)

negative regulation of apoptotic process (IEA,ISO,ISS)

negative regulation of DNA-templated transcription (IEA,ISO,ISS)

negative regulation of transcription by RNA polymerase II (IGI)

positive regulation of cell population proliferation (IEA,ISO,ISS)

positive regulation of DNA-templated transcription (IGI,IMP,ISO,ISS)

positive regulation of gene expression (IMP)

positive regulation of transcription by RNA polymerase II (IDA,IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

urea transmembrane transport (IEA,ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IDA,IMP,ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription factor activity (IDA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IDA,IEA)

HMG box domain binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO,ISS)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	The class III POU domain protein Brn-1 can fully replace the related Oct-6 during schwann cell development and myelination.	Friedrich RP, etal., Mol Cell Biol. 2005 Mar;25(5):1821-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Cooperative function of POU proteins and SOX proteins in glial cells.	Kuhlbrodt K, etal., J Biol Chem 1998 Jun 26;273(26):16050-7.
4.	RHS2, a POU domain-containing gene, and its expression in developing and adult rat.	Le Moine C and Young WS 3rd, Proc Natl Acad Sci U S A 1992 Apr 15;89(8):3285-9.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Redundancy of class III POU proteins in the oligodendrocyte lineage.	Schreiber J, etal., J Biol Chem 1997 Dec 19;272(51):32286-93.

Additional References at PubMed

PMID:8663425	PMID:9105675	PMID:11997177	PMID:12130536	PMID:12925600	PMID:15465489	PMID:16582099	PMID:17141158	PMID:17264314	PMID:18261853	PMID:19743445	PMID:31303265

Genomics

Comparative Map Data

Pou3f3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	52,438,026 - 52,441,152 (+)	NCBI		GRCr8
mRatBN7.2	9	44,945,872 - 44,948,998 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	44,945,872 - 44,948,992 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	53,439,603 - 53,442,731 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	58,562,401 - 58,565,529 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	56,843,728 - 56,846,854 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	49,479,148 - 49,482,246 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	49,479,023 - 49,482,252 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	49,152,036 - 49,154,632 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	41,873,891 - 41,876,408 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	41,875,036 - 41,877,823 (+)	NCBI
Celera	9	42,631,024 - 42,668,104 (+)	NCBI		Celera
Cytogenetic Map	9	q22	NCBI

POU3F3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	104,854,115 - 104,858,574 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	104,853,287 - 104,858,574 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	105,470,573 - 105,475,032 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	104,838,401 - 104,839,903 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	104,930,486 - 104,931,989	NCBI
Celera	2	99,673,184 - 99,674,686 (+)	NCBI		Celera
Cytogenetic Map	2	q12.1	NCBI
HuRef	2	99,242,289 - 99,243,259 (+)	NCBI		HuRef
CHM1_1	2	105,477,314 - 105,478,580 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	105,315,296 - 105,319,755 (+)	NCBI		T2T-CHM13v2.0

Pou3f3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	42,734,928 - 42,739,370 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	42,734,085 - 42,742,336 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	42,695,768 - 42,700,210 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	42,694,925 - 42,703,176 (+)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	1	42,695,768 - 42,703,176 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	42,753,991 - 42,757,055 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	42,641,692 - 42,643,185 (+)	NCBI		MGSCv36	mm8
MGSCv36	1	43,202,917 - 43,217,049 (+)	NCBI		MGSCv36	mm8
Celera	1	43,024,938 - 43,039,132 (+)	NCBI		Celera
Cytogenetic Map	1	B	NCBI
cM Map	1	21.21	NCBI

POU3F3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	22,855,977 - 22,859,194 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	22,858,742 - 22,861,974 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	96,967,943 - 96,972,378 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	105,944,786 - 105,945,424 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

POU3F3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	38,513,872 - 38,517,692 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	38,513,013 - 38,514,684 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	38,438,997 - 38,440,556 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	39,370,326 - 39,371,885 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	39,370,371 - 39,371,870 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	39,093,811 - 39,095,370 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	39,373,547 - 39,375,105 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	39,565,321 - 39,566,880 (-)	NCBI		UU_Cfam_GSD_1.0

POU3F3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	49,806,161 - 49,807,666 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	49,804,112 - 49,807,730 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	52,014,447 - 52,016,847 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103241369
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	8,511,032 - 8,513,449 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	176,224,571 - 176,225,176 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou3f3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624749	9,081,906 - 9,087,318 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou3f3
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	61
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000050922
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
1598823	Memor16	Memory QTL 16	1.9		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	22133322	49968732	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat

Markers in Region

D9M1Mit228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	9	41,872,187 - 41,872,322	UniSTS	RGSC3.4
Cytogenetic Map	9	q22	UniSTS

D1Mit228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	52,436,760 - 52,436,889 (+)	Marker Load Pipeline
Rnor_5.0	9	49,150,801 - 49,150,907	NCBI	Rnor5.0
RGSC_v3.4	9	41,872,398 - 41,872,526	UniSTS	RGSC3.4
Cytogenetic Map	9	q22	UniSTS

Pou3f1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	136,911,196 - 136,911,596 (+)	MAPPER	mRatBN7.2
mRatBN7.2	9	44,946,898 - 44,947,298 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	142,644,406 - 142,644,805	NCBI	Rnor6.0
Rnor_6.0	9	49,480,160 - 49,480,559	NCBI	Rnor6.0
Rnor_5.0	5	146,415,459 - 146,415,858	UniSTS	Rnor5.0
Rnor_5.0	9	49,152,546 - 49,152,945	UniSTS	Rnor5.0
Celera	5	135,434,689 - 135,435,106	UniSTS
Celera	9	42,666,018 - 42,666,417	UniSTS
Cytogenetic Map	5	q36	UniSTS
Cytogenetic Map	9	q22	UniSTS

Pou3f3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	44,947,722 - 44,948,812 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	49,480,983 - 49,482,072	NCBI	Rnor6.0
Rnor_5.0	9	49,153,369 - 49,154,458	UniSTS	Rnor5.0
Celera	9	42,666,841 - 42,667,930	UniSTS
Cytogenetic Map	9	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	2	27	107	58	59	32	15	32	6	143	56	93	45	52	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB453736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ001641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M84644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050922 ⟹ ENSRNOP00000040234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	44,945,872 - 44,948,992 (+)	Ensembl
Rnor_6.0 Ensembl	9	49,479,023 - 49,480,692 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077111 ⟹ ENSRNOP00000073663

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	49,479,137 - 49,482,252 (+)	Ensembl

RefSeq Acc Id:

NM_138837 ⟹ NP_620192

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	52,438,026 - 52,441,152 (+)	NCBI
mRatBN7.2	9	44,945,872 - 44,948,998 (+)	NCBI
Rnor_6.0	9	49,479,148 - 49,482,246 (+)	NCBI
Rnor_5.0	9	49,152,036 - 49,154,632 (+)	NCBI
RGSC_v3.4	9	41,873,891 - 41,876,408 (+)	RGD
Celera	9	42,631,024 - 42,668,104 (+)	NCBI

Sequence:

show sequence

GCGGCCGCGGCTGCTGCTGCGGCGGCGGCGGTGGTGGCGGCGGTGGGGTGGCGGGAGCGGAGCG
GCATGGCCACGGCGGCTTCTAACCCCTACCTGCCGGGGAACAGCCTGCTCGCGGCCGGATCCAT
TGTGCACTCGGACGCGGCCGGGGCGGGCGGCGGCGGAGGGGGCGGCGGCGGTGGCGGCGGCGGG
GCGGGGGGCGGCGGCGGCGGCATGCAGCCGGGAAGCGCCGCCGTGACCTCGGGCGCCTACCGGG
GGGATCCGTCCTCCGTCAAGATGGTCCAGAGTGACTTCATGCAGGGGGCCATGGCCGCCAGCAA
CGGCGGCCATATGCTGAGCCACGCGCACCAGTGGGTCACCGCCCTGCCCCACGCTGCCGCCGCT
GCCGCCGCTGCTGCCGCCGCCGCCGTGGAAGCCAGCTCACCGTGGTCGGGCAGCGCGGTGGGCA
TGGCCGGCAGCCCCCAGCAGCCACCACGGCCGCCGCCGCCGCCGCCGCAGGGCCCGGACGTGAA
GGGAGGCGTTGGACGCGAAGACTTGCACGCCGGCACAGCGTTGCACCACCGCGGACCGCCGCAC
TTGGGGCCCCCGCCACCGCCCCCTCACCAGGGACACCCTGGAGGCTGGGGGGCCGCAGCCGCCG
CTGCCGCTGCCGCCGCTGCCGCCGCTGCCGCCGCTCACCTCCCGTCCATGGCGGGCGGCCAGCA
GCCGCCGCCGCAGAGTCTGCTGTACTCGCAGCCCGGAGGCTTCACGGTGAACGGCATGCTGAGC
GCGCCCCCGGGGCCAGGCGGTGGCGGCGGCGGAGCGGGCGGTGGAGCCCAAAGCCTGGTTCACC
CGGGGTTAGTGCGCGGGGACACGCCCGAGCTGGCGGAGCATCATCACCACCATCACCACCACGC
GCACCCGCACCCGCCGCACCCGCACCACGCGCAGGGACCCCCACATCACGGTGGCGGCGGAGCG
GGGCCAGGACTCAACAGCCACGACCCGCACTCGGACGAGGACACGCCGACGTCTGACGACCTGG
AGCAGTTCGCTAAGCAGTTCAAGCAGCGGCGCATCAAGCTGGGTTTCACCCAGGCGGACGTGGG
GCTGGCTCTGGGCACTCTGTATGGCAATGTGTTCTCGCAGACCACCATCTGCCGCTTCGAGGCC
CTGCAGCTCAGTTTCAAGAACATGTGCAAGCTCAAGCCGTTGCTGAACAAGTGGCTGGAGGAGG
CAGACTCGAGCACCGGCAGCCCCACCAGCATTGACAAGATCGCAGCGCAGGGCCGCAAGCGCAA
GAAGCGGACCTCCATCGAGGTTAGCGTCAAAGGCGCGCTGGAGAGCCACTTCCTCAAGTGCCCT
AAACCCTCGGCGCAGGAGATCACCAACTTGGCCGACAGCCTGCAGCTGGAAAAGGAGGTCGTGC
GGGTCTGGTTCTGCAACCGACGCCAAAAGGAAAAACGCATGACGCCCCCTGGCATCCAGCAGCA
GACGCCGGACGATGTCTACTCGCAGGTGGGGACCGTGAGCGCTGACACACCGCCACCGCACCAC
GGGCTGCAGACCAGCGTGCAGTGAATGCCGGGGCGCAGCGCGAAGTGGGCCGCCGCCACCACCG
CCACCTCCGCAGCCGCTGTCAGCACCGCCACGGTCACCGCCGCTGCCGTCTTTGAGCGGCCGCC
GAGAACCACCGCCGCCGCTGCTGCCGCTGCTGCCGCCGCCGCCGCCGCCGCCGCCGCCGCTGCC
GCCGCGCAGACCCAACACCTGGCCAGTGCCAGGGTGACCAGGCCTCCTCCCCTCCGCCCAAAGA
CAGGCGAGCCATGGCCCTAGGAGGGGGGAGAACAGCTGGAGACCGATGAGACTCTTTCTGAAGT
CCAAGGAAGGAGGGACCAAAAACAAATTTTTAAGCATAATAAATACCAAGACTGTTTTATATGC
ATATATAACAAACAAAACCGGAAGAGGAAAAGGGAGGAACAAGGACATCTCGTTTATACTGTGG
TGGTGTTTTGTTCCTGTTTTGAAAGAAGGGTGAAGATGCCTAACGCACCAAAACTACACACGAG
GTACTGTCCACACCGAGATGTCCTGCTCGGCGACAGTGGAGAACACCTGCCTCTGAGATAAGAG
AGACCCCCTCCCCGTTCTTCCACTTCTTCCAAAAGGGCTGCCTAAAAGATCCATGGAAACTTTC
TTTACTGGGAGCGACCTGAAAAGAAAGACGCACCAGGTTTCCTGCAGGTCTGACTCTGCTCCTC
GACAGTGTTTTTCTTGGCCATATTCAAGTCTTTGGGGAACAAATAAATCAACTAAGAAATGGGA
AGGAAGGAGAAACAGAGTCTGGGGGGGGAGGGAAGATTCACAGCTTCTGAAGTTAACAGACTGA
ACAGGAAAGCCAAAAGAAAGCATCCTTGCCGTAAACTTGGGAATAAAAGCATCGCGAAAGAGCC
TTTGAGACCGCCCAGAAGGGCCAGGTCTCCCCCACGCCACTGAACCCGGGCTTTGCCGACTGCC
GCTCGGGGTGGACCATGCCTAAAGATTCCGCCGCTAATATTTTTTTTATTAACATTTTTTATTT
TTTATTTCTGGACTGACTCCGATAAAAGGGTGTGGAAAAGACAGCACCAACCGCGCACTTCCCT
TGACTTCTGCCCTCGATCCGTTGCCAACTTTGATTGAATGGGTGCTGCGGATGTGATTATGTAA
TACTGCCATTTCCAAGCAGTGTTTTTGGTAGGTTTTAATAAACAGACTTTTCAAATGACGGCAA
TATAGAATCGTTAGATCCGTTGTTGATCTAAAAATATTTGCTTTATATTTTCATTAAATGACTT
CTTTTAATATTTTATTCAAAATACTTATGAACTGCTGCAAAACGGTAATTTATTTTTCCCCAGA
TCTTGTATTACGTGTTTTTTTCAGACGAGCACAAATCAAAATGAAATGAAAATATGGACAGTTG
TTAGGTAATAAGGGTATCTTTTGATGTGATCATTTGATTGTAATTTAATTTGAGTAGTGATTCC
GTAAGAGCTGATTGAGAAAATAAATTTTGTCGAGGCGGCCGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_620192	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42041	(Get FASTA)	NCBI Sequence Viewer
	BAH22584	(Get FASTA)	NCBI Sequence Viewer
	CAA04893	(Get FASTA)	NCBI Sequence Viewer
	EDL99157	(Get FASTA)	NCBI Sequence Viewer
	EDL99158	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000040234.6
GenBank Protein	Q63262	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620192 ⟸ NM_138837

- UniProtKB:

Q63262 (UniProtKB/Swiss-Prot), F1M7A3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATAASNPYLPGNSLLAAGSIVHSDAAGAGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRG
DPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAAAAAAVEASSPWSGSAVGM
AGSPQQPPRPPPPPPQGPDVKGGVGREDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAA
AAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHP
GLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGAGPGLNSHDPHSDEDTPTSDDLE
QFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEA
DSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVR
VWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000073663 ⟸ ENSRNOT00000077111

Ensembl Acc Id:

ENSRNOP00000040234 ⟸ ENSRNOT00000050922

Protein Domains

Homeobox POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63262-F1-model_v2	AlphaFold	Q63262	1-497	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619768	AgrOrtholog
BioCyc Gene	G2FUF-27684	BioCyc
Ensembl Genes	ENSRNOG00000038909	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050922.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_domain_TF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:192109	UniProtKB/Swiss-Prot
NCBI Gene	192109	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU DOMAIN, CLASS 3, TRANSCRIPTION FACTOR 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pou	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pou3f3	PhenoGen
PIRSF	Transcription_factor_POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000038909	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47413	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6INQ2_RAT	UniProtKB/TrEMBL
	F1M7A3	ENTREZGENE, UniProtKB/TrEMBL
	PO3F3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Pou3f3	POU class 3 homeobox 3	Pou3f3	POU domain, class 3, transcription factor 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Pou3f3	POU domain, class 3, transcription factor 3			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Pou3f3	POU domain, class 3, transcription factor 3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the class III POU proteins which also includes st-1/Oct6/SCIP and Brn2	633620

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM