Advanced Search (OLGA)

Gene: Gng7 (G protein subunit gamma 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gng7

Name:

G protein subunit gamma 7

RGD ID:

61860

Description:

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway and regulation of adenylate cyclase activity. Predicted to act upstream of or within behavioral fear response; locomotory behavior; and receptor guanylyl cyclase signaling pathway. Is active in Schaffer collateral - CA1 synapse; parallel fiber to Purkinje cell synapse; and synaptic vesicle membrane. Orthologous to human GNG7 (G protein subunit gamma 7); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

PROVISIONAL

Previously known as:

guanine nucleotide binding protein (G protein) gamma 7 subunit; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide binding protein (G protein), gamma 7 subunit; guanine nucleotide binding protein, gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; heterotrimeric guanine nucleotide-binding protein 3b; Hg3b

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG7 (G protein subunit gamma 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gng7 (guanine nucleotide binding protein (G protein), gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gng7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gng7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNG7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng7 (G protein subunit gamma 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Gng7 (guanine nucleotide binding protein (G protein), gamma 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNG7 (G protein subunit gamma 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng7 (guanine nucleotide binding protein (G protein), gamma 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG43324	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gng7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,348,148 - 9,411,924 (+)	NCBI		GRCr8
mRatBN7.2	7	8,697,458 - 8,761,239 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,697,521 - 8,761,240 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,599,151 - 11,644,744 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,474,646 - 13,520,238 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,341,144 - 11,386,783 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,565,740 - 11,629,519 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,582,984 - 11,628,929 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,750,286 - 11,796,771 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,203,112 - 10,271,719 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	10,203,111 - 10,271,719 (+)	NCBI
Celera	7	6,901,358 - 6,946,858 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	Neurodevelopmental Disorders		ISO	GNG7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Gng7	Rat	progressive myoclonus epilepsy 9		ISO	GNG7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy type 9	ClinVar	PMID:28492532
Gng7	Rat	RASopathy		ISO	GNG7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy	ClinVar	PMID:23379592 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	Esophageal Neoplasms		ISO	GNG7 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18219292

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Gng7	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Gng7	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gng7 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GNG7 mRNA	CTD	PMID:24680724
Gng7	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of GNG7 protein	CTD	PMID:34915118
Gng7	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Gng7 (Mus musculus)	6480464	bisphenol S results in increased methylation of GNG7 exon	CTD	PMID:33297965
Gng7	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	GNG7 (Homo sapiens)	6480464	Decitabine affects the expression of GNG7 mRNA	CTD	PMID:23300844
Gng7	Rat	5-azacytidine	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	Azacitidine affects the methylation of GNG7 promoter	CTD	PMID:18219292
Gng7	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of GNG7 mRNA	CTD	PMID:30047161
Gng7	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of GNG7 mRNA	CTD	PMID:28959563
Gng7	Rat	aflatoxin B1	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of GNG7 mRNA	CTD	PMID:21641981 and PMID:32234424
Gng7	Rat	aflatoxin B1	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	Aflatoxin B1 affects the methylation of GNG7 intron	CTD	PMID:30157460
Gng7	Rat	Aflatoxin B2 alpha	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	aflatoxin B2 affects the methylation of GNG7 intron	CTD	PMID:30157460
Gng7	Rat	all-trans-retinoic acid	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Tretinoin results in decreased expression of GNG7 mRNA	CTD	PMID:33167477
Gng7	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of GNG7 mRNA	CTD	PMID:30047161
Gng7	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of GNG7 mRNA	CTD	PMID:16483693
Gng7	Rat	aristolochic acid A	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of GNG7 mRNA	CTD	PMID:33212167
Gng7	Rat	arsane	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	Arsenic affects the methylation of GNG7 gene	CTD	PMID:25304211
Gng7	Rat	arsane	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	arsenic atom	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	Arsenic affects the methylation of GNG7 gene	CTD	PMID:25304211
Gng7	Rat	arsenic atom	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	arsenite(3-)	increases expression	ISO	Gng7 (Mus musculus)	6480464	arsenite results in increased expression of GNG7 mRNA	CTD	PMID:33053406
Gng7	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of GNG7 mRNA	CTD	PMID:36841081
Gng7	Rat	Azoxymethane	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNG7 mRNA	CTD	PMID:29950665
Gng7	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of GNG7 mRNA	CTD	PMID:21839799
Gng7	Rat	benzo[a]pyrene	decreases methylation	ISO	GNG7 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of GNG7 3' UTR	CTD	PMID:27901495
Gng7	Rat	benzo[a]pyrene	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of GNG7 5' UTR and Benzo(a)pyrene affects the methylation of GNG7 intron	CTD	PMID:27901495 and PMID:30157460
Gng7	Rat	benzo[a]pyrene	increases methylation	ISO	GNG7 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of GNG7 promoter	CTD	PMID:27901495
Gng7	Rat	benzo[a]pyrene	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of GNG7 mRNA	CTD	PMID:21632981 more ...
Gng7	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	7 more ...	CTD	PMID:26238291
Gng7	Rat	benzo[e]pyrene	decreases methylation	ISO	GNG7 (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of GNG7 intron	CTD	PMID:30157460
Gng7	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GNG7 mRNA	CTD	PMID:25181051 more ...
Gng7	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of GNG7 mRNA	CTD	PMID:34947998
Gng7	Rat	butanal	increases expression	ISO	GNG7 (Homo sapiens)	6480464	butyraldehyde results in increased expression of GNG7 mRNA	CTD	PMID:26079696
Gng7	Rat	cadmium atom	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GNG7 mRNA	CTD	PMID:35301059
Gng7	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of GNG7 promoter	CTD	PMID:22457795
Gng7	Rat	cadmium dichloride	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GNG7 mRNA	CTD	PMID:35301059
Gng7	Rat	cadmium dichloride	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of GNG7 mRNA	CTD	PMID:38382870
Gng7	Rat	cannabidiol	affects methylation	EXP		6480464	Cannabidiol affects the methylation of GNG7 gene	CTD	PMID:30521419
Gng7	Rat	chlordecone	decreases expression	ISO	Gng7 (Mus musculus)	6480464	Chlordecone results in decreased expression of GNG7 mRNA	CTD	PMID:33711761
Gng7	Rat	chlorpyrifos	increases expression	ISO	Gng7 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of GNG7 mRNA	CTD	PMID:32715474
Gng7	Rat	choline	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of GNG7 gene	CTD	PMID:20938992
Gng7	Rat	cisplatin	affects expression	ISO	GNG7 (Homo sapiens)	6480464	Cisplatin affects the expression of GNG7 mRNA	CTD	PMID:23300844
Gng7	Rat	copper atom	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of GNG7 mRNA	CTD	PMID:30911355
Gng7	Rat	copper(0)	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of GNG7 mRNA	CTD	PMID:30911355
Gng7	Rat	crocidolite asbestos	increases expression	ISO	Gng7 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of GNG7 mRNA	CTD	PMID:29279043
Gng7	Rat	dextran sulfate	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNG7 mRNA	CTD	PMID:29950665
Gng7	Rat	dichloroacetic acid	decreases expression	ISO	Gng7 (Mus musculus)	6480464	Dichloroacetic Acid results in decreased expression of GNG7 mRNA	CTD	PMID:28962523
Gng7	Rat	diethyl malate	affects expression	ISO	Gng7 (Mus musculus)	6480464	diethyl malate affects the expression of GNG7 mRNA	CTD	PMID:24814887
Gng7	Rat	dorsomorphin	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GNG7 mRNA	CTD	PMID:27188386
Gng7	Rat	doxorubicin	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of GNG7 mRNA	CTD	PMID:29803840
Gng7	Rat	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of GNG7 mRNA	CTD	PMID:32289291
Gng7	Rat	entinostat	increases expression	ISO	GNG7 (Homo sapiens)	6480464	entinostat results in increased expression of GNG7 mRNA	CTD	PMID:27188386
Gng7	Rat	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of GNG7 mRNA	CTD	PMID:20655511
Gng7	Rat	ethanol	affects splicing	ISO	Gng7 (Mus musculus)	6480464	Ethanol affects the splicing of GNG7 mRNA	CTD	PMID:30319688
Gng7	Rat	ethanol	increases expression	ISO	Gng7 (Mus musculus)	6480464	Ethanol results in increased expression of GNG7 mRNA	CTD	PMID:30319688
Gng7	Rat	ethyl methanesulfonate	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of GNG7 mRNA	CTD	PMID:23649840
Gng7	Rat	folic acid	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of GNG7 gene	CTD	PMID:20938992
Gng7	Rat	folic acid	decreases expression	ISO	Gng7 (Mus musculus)	6480464	Folic Acid results in decreased expression of GNG7 mRNA	CTD	PMID:25629700
Gng7	Rat	fonofos	increases methylation	ISO	GNG7 (Homo sapiens)	6480464	Fonofos results in increased methylation of GNG7 promoter	CTD	PMID:22847954
Gng7	Rat	formaldehyde	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of GNG7 mRNA	CTD	PMID:23649840
Gng7	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of GNG7 gene	CTD	PMID:22079235
Gng7	Rat	genistein	increases expression	ISO	GNG7 (Homo sapiens)	6480464	Genistein results in increased expression of GNG7 mRNA	CTD	PMID:18847459
Gng7	Rat	L-methionine	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of GNG7 gene	CTD	PMID:20938992
Gng7	Rat	manganese atom	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	manganese(0)	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	manganese(II) chloride	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	methapyrilene	decreases methylation	ISO	GNG7 (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of GNG7 intron	CTD	PMID:30157460
Gng7	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of GNG7 mRNA	CTD	PMID:30047161
Gng7	Rat	methyl methanesulfonate	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of GNG7 mRNA	CTD	PMID:23649840
Gng7	Rat	methylmercury chloride	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of GNG7 mRNA	CTD	PMID:28001369
Gng7	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of GNG7 mRNA	CTD	PMID:36314267
Gng7	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	GNG7 (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of GNG7 mRNA	CTD	PMID:24810058
Gng7	Rat	N-Nitrosopyrrolidine	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	N-Nitrosopyrrolidine results in decreased expression of GNG7 mRNA	CTD	PMID:32234424
Gng7	Rat	nickel atom	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Nickel results in decreased expression of GNG7 mRNA	CTD	PMID:25583101
Gng7	Rat	niclosamide	increases expression	ISO	GNG7 (Homo sapiens)	6480464	Niclosamide results in increased expression of GNG7 mRNA	CTD	PMID:36318118
Gng7	Rat	nitroglycerin	decreases expression	EXP		6480464	Nitroglycerin results in decreased expression of GNG7 mRNA	CTD	PMID:12102619
Gng7	Rat	Nor-9-carboxy-delta9-THC	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of GNG7 gene	CTD	PMID:30521419
Gng7	Rat	O-methyleugenol	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	methyleugenol results in decreased expression of GNG7 mRNA	CTD	PMID:32234424
Gng7	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of GNG7 mRNA	CTD	PMID:33387578
Gng7	Rat	parathion	increases methylation	ISO	GNG7 (Homo sapiens)	6480464	Parathion results in increased methylation of GNG7 promoter	CTD	PMID:22847954
Gng7	Rat	PCB138	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Gng7	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Gng7 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of GNG7 mRNA	CTD	PMID:37995155
Gng7	Rat	phenylmercury acetate	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of GNG7 mRNA	CTD	PMID:26272509
Gng7	Rat	phenylmercury acetate	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GNG7 mRNA	CTD	PMID:27188386
Gng7	Rat	potassium dichromate	increases expression	ISO	Gng7 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of GNG7 mRNA	CTD	PMID:23608068
Gng7	Rat	propanal	increases expression	ISO	GNG7 (Homo sapiens)	6480464	propionaldehyde results in increased expression of GNG7 mRNA	CTD	PMID:26079696
Gng7	Rat	protein kinase inhibitor	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in decreased expression of GNG7 mRNA]	CTD	PMID:28003376
Gng7	Rat	SB 431542	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GNG7 mRNA	CTD	PMID:27188386
Gng7	Rat	sodium arsenite	affects methylation	ISO	GNG7 (Homo sapiens)	6480464	sodium arsenite affects the methylation of GNG7 gene	CTD	PMID:28589171
Gng7	Rat	sodium arsenite	multiple interactions	ISO	GNG7 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GNG7 mRNA	CTD	PMID:39836092
Gng7	Rat	sodium arsenite	increases expression	ISO	GNG7 (Homo sapiens)	6480464	sodium arsenite results in increased expression of GNG7 mRNA	CTD	PMID:38568856
Gng7	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of GNG7 mRNA	CTD	PMID:30047161
Gng7	Rat	sunitinib	increases expression	ISO	GNG7 (Homo sapiens)	6480464	Sunitinib results in increased expression of GNG7 mRNA	CTD	PMID:31533062
Gng7	Rat	terbufos	increases methylation	ISO	GNG7 (Homo sapiens)	6480464	terbufos results in increased methylation of GNG7 promoter	CTD	PMID:22847954
Gng7	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of GNG7 mRNA	CTD	PMID:31150632
Gng7	Rat	thimerosal	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	Thimerosal results in decreased expression of GNG7 mRNA	CTD	PMID:27188386
Gng7	Rat	titanium dioxide	multiple interactions	ISO	Gng7 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNG7 mRNA	CTD	PMID:29950665
Gng7	Rat	titanium dioxide	decreases methylation	ISO	Gng7 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of GNG7 gene and titanium dioxide results in decreased methylation of GNG7 promoter	CTD	PMID:35295148
Gng7	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of GNG7 gene	CTD	PMID:27618143
Gng7	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of GNG7 mRNA	CTD	PMID:33387578
Gng7	Rat	trichostatin A	affects expression	ISO	GNG7 (Homo sapiens)	6480464	trichostatin A affects the expression of GNG7 mRNA	CTD	PMID:28542535
Gng7	Rat	triphenyl phosphate	affects expression	ISO	GNG7 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of GNG7 mRNA	CTD	PMID:37042841
Gng7	Rat	valproic acid	affects expression	ISO	GNG7 (Homo sapiens)	6480464	Valproic Acid affects the expression of GNG7 mRNA	CTD	PMID:25979313
Gng7	Rat	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of GNG7 promoter	CTD	PMID:33150595
Gng7	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of GNG7 mRNA	CTD	PMID:33150595
Gng7	Rat	valproic acid	increases expression	ISO	GNG7 (Homo sapiens)	6480464	Valproic Acid results in increased expression of GNG7 mRNA	CTD	PMID:28001369 and PMID:29154799
Gng7	Rat	zoledronic acid	decreases expression	ISO	GNG7 (Homo sapiens)	6480464	zoledronic acid results in decreased expression of GNG7 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	behavioral fear response	acts_upstream_of_or_within	ISO	Gng7 (Mus musculus)	1624291	MGI:2451322 PMID:12488442	RGD	PMID:12488442
Gng7	Rat	biological_process		ND		1598407	11/2008: no relevant rat data	RGD
Gng7	Rat	G protein-coupled receptor signaling pathway	involved_in	IBA	MGI:102705 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gng7	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR001770 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gng7	Rat	locomotory behavior	acts_upstream_of_or_within	ISO	Gng7 (Mus musculus)	1624291	MGI:2451322 PMID:12488442	RGD	PMID:12488442
Gng7	Rat	receptor guanylyl cyclase signaling pathway	acts_upstream_of_or_within	ISO	Gng7 (Mus musculus)	1624291	MGI:2451322 PMID:12488442	RGD	PMID:12488442
Gng7	Rat	regulation of adenylate cyclase activity	involved_in	ISO	Gng7 (Mus musculus)	1624291	PMID:12488442	RGD	PMID:12488442
Gng7	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	heterotrimeric G-protein complex		NAS		61610		RGD
Gng7	Rat	heterotrimeric G-protein complex	part_of	IEA	InterPro:IPR001770	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gng7	Rat	heterotrimeric G-protein complex	part_of	IBA	PANTHER:PTN001013516 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gng7	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gng7	Rat	parallel fiber to Purkinje cell synapse	is_active_in	IDA		405650368	PMID:12837624	SynGO
Gng7	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gng7	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gng7	Rat	Schaffer collateral - CA1 synapse	is_active_in	IDA		405650368	PMID:12837624	SynGO
Gng7	Rat	synapse	is_active_in	ISO	Gng7 (Mus musculus)	1624291	PMID:34932372	RGD	PMID:34932372
Gng7	Rat	synaptic vesicle membrane	is_active_in	IDA		405650368	PMID:12837624	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	G-protein beta-subunit binding	enables	IEA	InterPro:IPR001770	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gng7	Rat	G-protein beta-subunit binding	enables	IBA	PANTHER:PTN001013516 and UniProtKB:P59768	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gng7	Rat	protein binding	enables	ISO	GNG7 (Homo sapiens)	1624291	UniProtKB:Q9H8Y8 and PMID:32296183	RGD	PMID:32296183

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gng7	Rat	chemokine mediated signaling pathway		IEA		6907045		KEGG	rno:04062
Gng7	Rat	glutamate signaling pathway		IEA		6907045		KEGG	rno:04724

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Functional G-protein heterotrimers are associated with vesicles of putative glutamatergic terminals: implications for regulation of transmitter uptake.	Pahner I, etal., Mol Cell Neurosci. 2003 Jul;23(3):398-413. doi: 10.1016/s1044-7431(03)00059-9.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
11.	G-protein gamma 7 subunit is selectively expressed in medium-sized neurons and dendrites of the rat neostriatum.	Watson JB, etal., J Neurosci Res 1994 Sep 1;39(1):108-16.

PMID:12488442	PMID:19056867	PMID:20458337	PMID:22871113	PMID:23376485	PMID:23533145	PMID:29476059	PMID:30864685

Gng7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,348,148 - 9,411,924 (+)	NCBI		GRCr8
mRatBN7.2	7	8,697,458 - 8,761,239 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,697,521 - 8,761,240 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,599,151 - 11,644,744 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,474,646 - 13,520,238 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,341,144 - 11,386,783 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,565,740 - 11,629,519 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,582,984 - 11,628,929 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,750,286 - 11,796,771 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,203,112 - 10,271,719 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	10,203,111 - 10,271,719 (+)	NCBI
Celera	7	6,901,358 - 6,946,858 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

GNG7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	2,511,219 - 2,702,694 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	2,511,219 - 2,702,694 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	2,511,217 - 2,702,692 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	2,462,218 - 2,653,746 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	2,462,217 - 2,653,663	NCBI
Celera	19	2,448,700 - 2,582,967 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	2,283,412 - 2,473,064 (-)	NCBI		HuRef
CHM1_1	19	2,510,897 - 2,702,318 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	2,487,421 - 2,678,899 (-)	NCBI		T2T-CHM13v2.0

Gng7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,784,463 - 80,850,742 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,784,458 - 80,850,779 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	80,948,624 - 81,014,925 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,948,624 - 81,014,945 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	80,411,369 - 80,477,670 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,351,753 - 80,418,054 (-)	NCBI		MGSCv36	mm8
Celera	10	81,968,024 - 82,035,023 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Gng7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	4,889,198 - 4,893,353 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	4,889,198 - 4,995,288 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNG7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	6,897,432 - 7,095,635 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	6,126,732 - 6,324,997 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	1,525,479 - 1,723,139 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	2,489,311 - 2,665,011 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	2,489,311 - 2,498,934 (-)	Ensembl	panpan1.1		panPan2

GNG7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	56,479,337 - 56,603,972 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	56,275,567 - 56,400,055 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	57,212,608 - 57,337,139 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	20	56,265,642 - 56,389,829 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	56,750,522 - 56,874,921 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	56,950,908 - 57,074,978 (+)	NCBI		UU_Cfam_GSD_1.0

Gng7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,269,226 - 216,333,396 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	1,503,836 - 1,507,178 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	1,501,386 - 1,565,557 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	76,039,656 - 76,083,555 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	75,929,877 - 76,083,557 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	76,590,549 - 76,634,454 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNG7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	2,287,339 - 2,485,304 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	2,287,895 - 2,293,067 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	6,150,479 - 6,365,756 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	5,685,915 - 5,690,729 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	5,683,248 - 5,803,088 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gng7
479 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	137
Count of miRNA genes:	109
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000026893
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

RH128936

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,758,931 - 8,759,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,627,212 - 11,627,393	NCBI	Rnor6.0
Rnor_5.0	7	11,794,465 - 11,794,646	UniSTS	Rnor5.0
RGSC_v3.4	7	10,270,002 - 10,270,183	UniSTS	RGSC3.4
Celera	7	6,945,141 - 6,945,322	UniSTS
Cytogenetic Map	7	q11	UniSTS

UniSTS:496688

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	8,757,114 - 8,758,201 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	11,625,395 - 11,626,481	NCBI	Rnor6.0
Rnor_5.0	7	11,792,648 - 11,793,734	UniSTS	Rnor5.0
RGSC_v3.4	7	10,268,185 - 10,269,271	UniSTS	RGSC3.4
Celera	7	6,943,324 - 6,944,410	UniSTS
Cytogenetic Map	7	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	3	49	112	83	83	52	25	52	6	200	91	93	45	60	31


RefSeq Transcripts	NM_024138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC103000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L23219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026893 ⟹ ENSRNOP00000026893

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,697,521 - 8,761,240 (+)	Ensembl
Rnor_6.0 Ensembl	7	11,582,984 - 11,628,929 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,711,521 - 8,761,240 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095151

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,714,843 - 8,761,240 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110558

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,697,530 - 8,761,240 (+)	Ensembl

RefSeq Acc Id:

NM_024138 ⟹ NP_077052

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,365,389 - 9,411,335 (+)	NCBI
mRatBN7.2	7	8,714,693 - 8,760,650 (+)	NCBI
Rnor_6.0	7	11,582,984 - 11,628,929 (+)	NCBI
Rnor_5.0	7	11,750,286 - 11,796,771 (+)	NCBI
RGSC_v3.4	7	10,203,112 - 10,271,719 (+)	RGD
Celera	7	6,901,358 - 6,946,858 (+)	RGD

Sequence:

show sequence

AGGCACCAAACCCTAGTTTGCCGGGGCCTCCGGAGCAGCTGGCTGAGGGTTCCTGTCGCTGCCTGGGCCGGGTGTGACCTCCCGTCCACACAGACCCAGACACCAGCCTGGCACCCTGCGGTGCCAAA
TTAATGCACAGTATTTCTCTTCCAGGGTGTGAAGCCTTCCTATTGGAACCTCGGTGCTGGGACAGTGGGACTCAGAGCAGCTCTCTAGACGCCAGGTCCACGCTCATGGCTGATGATGTCAGGTACTA
ACAACGTCGCCCAGGCCCGGAAGCTGGTGGAGCAGTTGCGCATCGAAGCTGGGATCGAACGCATCAAGGTCTCCAAGGCCTCGTCAGAACTGATGAGCTACTGTGAGCAACATGCCCGGAATGACCCC
TTGCTGGTTGGTGTACCAGCCTCTGAAAATCCATTCAAAGACAAAAAGCCTTGCATAATTCTCTAGTTCTCTCTCTCTTCCTCCCTCCTTCCTCTCCCTCTCTTTCTCCCCACCCCAAAGGTATTGTC
CAGTTTTTCCTGTAAGAAAAAAATATTTGAATCCCTTCTACTTTGAATTTTAAAGGAACAGAAACCATTGTGAATGCCTGGAGCCTCCTGACCTAGCTGGAGTTCGTCCTGGCCTAACTTTAGCCTCA
TCCACCCCCTCCCGTCGAGAACCACTGATGTGACAGTTTTTAAGCTCCCCTTAGTTGGCCTGGGGAAAGGGTTCTGTTGGCCAACGGCGAGCCTAGCAAGTTTGCGGACCATAGCTGCAGTCCTCGGG
TCCCACATAAAACATGCAGGTGCGGTGTCAGAAGGCTGAGATGGAAGGATCCCCGAGGCTTGGGGACTGCATCCTAGCAGCCAGTAAACTCCAGACAGTGAGAAACGATGCCTCCAAACACAAGGCAG
AGGAGGATACCCAGCCTTGACCTCTGGCTCCACACGCGGCACACACAATGCACCCTGTACTACCCAGTGTCATTCTCGAGTGGCCCTGTCGTGTGCACGGTGACAGTGATGCCCTTTCTCCAGAGAGT
TGGCCCATTCTAGAAACGGGCATTTGGGTCTCCATACAAAGGAAGCACTTGCTGGTATGGCCGAGTGTGTAACTTTGTCTCCGAAGCCTGAGATCCATGTGTTCATTGGTGACTCCTCGTTTTTCTCC
CAGTTACACAGATGGTTGTGAGGGCAGAAGTGCAGATTTAATTATCTTGAGGTGATTGAGAAGGACCGATGGGGTTCTCCATCCCACACGTGACTGTGCCTCCAGATCCCCCTTCCTGGGTCAAACTA
TTTTTTAACTAACTAGAACCCAAGTCCCTCAATGTGTGGACTGTGGCCATTTTCTGCACTCCTTCATTGGGAGATTCATCTCTGACCACACCCCCAACCCCTCACTGAGGGATTCTAGACGGGGCTCC
ACCCCTGACCACGCCCCAGTCCCCCATTGAGGGATTCTAGAAGGGGTTCCACCTCTGACCATGCCTCAGCCCCCTACTGGGGATTCTAGAAGGGGCTCCACCCTGACCACGCCCCCAGACCCTTACTG
GTAAATTCTAGATGGCACTCCACTTCTGAGGCGGGCATCTTCTCTATTGTGTGAGCAGAGCCCTAGAGTCCAGGCTGGCCTGGACTGGAACTGGAGATCTTCCTGCCTCTGGCTCCGGAGTACCTACC
TGATAGGCCTGTGTTGCATGCCTGGCATCGGATTGGACGGAAGATGACAGACCGTCTGTCTATGACAGTGACAGTGGCAGGTCTAGGGAGGACACAGCTTAGGTGTGCCAGTGTGGTCTGCAGCCATA
CACAAAGGCATCTCAAGCATTTGAGACTCCAGTTACCTCTTTCTCCTGCCGGATCAGTGTGGGAGCAGAAATGAAGCCAGTCCAGTTACTCCCTGCAGCTCTGGTGGAAATCTGCTTCCCAAACCCTG
TGCCAGGCTCATCCCTGGACAGTTGCTCAAACTGCCCATGGGCAAAGTGAATGGAGCTGGCAGATCTGGCTCCTAGCCTATTAGGCACAACCTACCACCTAGATAAGGTGGCAGCCCCCCCCCTCCCC
AGTCCATTTGATGGAATCAGGGAAAGAAGTTTGGGATGTGACTAAGGGGGAGGGGCACTGCAGGTGCTAAGAGAGGACCCTGTTTCCCCCTCCATGGGCCACAGAGAGCACAGACCAAGGGTCAGGCC
CCTCCTGTGCACTGACTCCCAATTACTGGTCAGAGAGGGCCAGGACTTTGGTGAGCCTGACTCTCAGAACCTGTGGTGGAATCAGAAAAGCCAGTGTCCCTCCAGAACTGCAGCCACCTTTCATTAGG
CTAGGAACCAGGTCCCAGCAGGTGTGTCTCCAGCTGCACTGGCAGGGGACAGTGAGGAGAGAGGAAAGGACATACATTCTGGGGACCGGGACTGCAGAACACCCAGCCAGTATGGTAGAAACCTGGGT
TCCACCCCAAGCTCGCAAAAAAACAGGCATGGGCACTGGGGATGTAGAGGCAGGAAGATCAGAACTTCAGGGTCTTTCTCAGCCACAGGATGGGCTCAAGGTTAGCCTGGGCTGCATGAGACCATGTC
TCAAAGACAGAAATCTCAGTGTGCTCTCTCATGTTCCTAACACGCCTGATTGTTTCCCTCTGGAGGCTGCTGTGCCAGCCTGGCCAGCCTGCGTTTGGTCGCAGCCTTGTTTCTCAGCTCTGGGACAA
AAACTCAAATCTGCATCTCTGCCCACACCTCCAGTTCCCCCTCCCCGGGTGACTCACAGGCCAAGGACAAAGTGGCCTCTTGCTCCCAGGGAGGGTAGGATGTGCTGGTGTAGCCTGTGTACGTCCTA
AGCACTGGAGCCCTGCCTCGGCCTAGAGACGCTTAGGGAAACCAGAACACATCAGAGCAATTAGGAGCCAAGAATGGTGGC

hide sequence

RefSeq Acc Id:

XM_017595070 ⟹ XP_017450559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,348,148 - 9,411,924 (+)	NCBI
mRatBN7.2	7	8,697,458 - 8,761,239 (+)	NCBI
Rnor_6.0	7	11,565,740 - 11,629,519 (+)	NCBI

Sequence:

show sequence

GGGGAACCCCGCCCCATGGAAGAGCCCTCTTTAGGCCCCGCGGTGCGTTTGGCAGCGCGGCTACTGAGACACTGGCGGGAGGCAGGGTGTGAAGCCTTCCTATTGGAACCTCGGTGCTGGGACAGTGG
GACTCAGAGCAGCTCTCTAGACGCCAGGTCCACGCTCATGGCTGATGATGTCAGGTACTAACAACGTCGCCCAGGCCCGGAAGCTGGTGGAGCAGTTGCGCATCGAAGCTGGGATCGAACGCATCAAG
GTCTCCAAGGCCTCGTCAGAACTGATGAGCTACTGTGAGCAACATGCCCGGAATGACCCCTTGCTGGTTGGTGTACCAGCCTCTGAAAATCCATTCAAAGACAAAAAGCCTTGCATAATTCTCTAGTT
CTCTCTCTCTTCCTCCCTCCTTCCTCTCCCTCTCTTTCTCCCCACCCCAAAGGTATTGTCCAGTTTTTCCTGTAAGAAAAAAATATTTGAATCCCTTCTACTTTGAATTTTAAAGGAACAGAAACCAT
TGTGAATGCCTGGAGCCTCCTGACCTAGCTGGAGTTCGTCCTGGCCTAACTTTAGCCTCATCCACCCCCTCCCGTCGAGAACCACTGATGTGACAGTTTTTAAGCTCCCCTTAGTTGGCCTGGGGAAA
GGGTTCTGTTGGCCAAAGGCGAGCCTAGCAAGTTTGCGGACCATAGCTGCAGTCCTCGGGTCCCACATAAAACATGCAGGTGCGGTGTCAGAAGGCTGAGATGGAAGGATCCCCGAGGCTTGGGGACT
GCATCCTAGCAGCCAGTAAACTCCAGACAGTGAGAAACGATGCCTCCAAACACAAGGCAGAGGAGGATACCCAGCCTTGACCTCTGGCTCCACACGCGGCACACACAATGCACCCTGTACTACCCAGT
GTCATTCTCGAGTGGCCCTGTCGTGTGCACGGTGACAGTGATGCCCTTTCTCCAGAGAGTTGGCCCATTCTAGAAACGGGCATTTGGGTCTCCATACAAAGGAAGCACTTGCTGGTATGGCCGAGTGT
GTAACTTTGTCTCCGAAGCCTGAGATCCATGTGTTCATTGGTGACTCCTCGTTTTTCTCCCAGTTACACAGATGGTTGTGAGGGCAGAAGTGCAGATTTAATTATCTTGAGGTGATTGAGAAGGACCG
ATGGGGTTCTCCATCCCACATCGTGACTGTGCCTCCAGATCCCCCTTCCTGGGTCAAACTATTTTTTAACTAACTAGAACCCAAGTCCCTCAATGTGTGGACTGTGGCCATTTTCTGCACTCCTTCAT
TGGGAGATTCATCTCTGACCACACCCCCAACCCCTCACTGAGGGATTCTAGACGGGGCTCCACCCCTGACCACGCCCCAGTCCCCCATTGAGGGATTCTAGAAGGGGTTCCACCTCTGACCATGCCTC
AGCCCCCTACTGGGGATTCTAGAAGGGGCTCCACCCTGACCACGCCCCCAGACCCTTACTGGTAAATTCTAGATGGCACTCCACTTCTGAGGCGGGCCTCTTCTCTATTGTGTGAGCAGAGCCCTAGA
GTCCAGGCTGGCCTGGACTGGAACTGGAGATCTTCCTGCCTCTGGCTCCGGAGTACCTACCTGATAGGCCTGTGTTGCATGCCTGGCATCGGATTGGACGGAAGATGACAGACCGTCTGTCTATGACA
GTGACAGTGGCAGGTCTAGGGAGGACACAGCTTAGGTGTGCCAGTGTGGTCTGCAGCCATACACAAAGGCATCTCAAGCATTTGAGACTCCAGTTACCTCTTTCTCCTGCCGGATCAGTGTGGGAGCA
GAAATGAAGCCAGTCCAGTTACTCCCTGCAGCTCTGGTGGAAATCTGCTTCCCAAACCCTGTGCCAGGCTCATCCCTGGACAGTTGCTCAAACTGCCCATGGGCAAAGTGAATGGAGCTGGCAGATCT
GGCTCCTAGCCTATTAGGCACAACCTACCACCTAGATAAGGTGGCAGCCCCCCCCCCCCCCAGTCCATTTGATGGAATCAGGGAAAGAAGTTTGGGATGTGACTAAGGGGGAGGGGCACTGCAGGTGC
TAAGAGAGGACCCTGTTTCCCCCTCCATGGGCCACAGAGAGCACAGACCAAGGGTCAGGCCCCTCCTGTGCACTGACTCCCAATTACTGGTCAGAGAGGGCCAGGACTTTGGTGAGCCTGACTCTCAG
AACCTGTGGTGGAATCAGAAAAGCCAGTGTCCCTCCAGAACTGCAGCCACCTTTCATTAGGCTAGGAACCAGGTCCCAGCAGGTGTGTCTCCAGCTGCACTGGCAGGGGACAGTGAGGAGAGAGGAAA
GGACATACATTCTGGGGACCGGGACTGCAGAACACCCAGCCAGTATGGTAGAAACCTGGGTTCCACCCCAAGCTCGCAAAAAAACAGGCATGGGCACTGGGGATGTAGAGGCAGGAAGATCAGAACTT
CAGGGTCTTTCTCAGCCACAGGATGGGCTCAAGGTTAGCCTGGGCTGCATGAGACCATGTCTCAAAGACAGAAATCTCAGTGTGCTCTCTCATGTTCCTAACACGCCTGATTGTTTCCCTCTGGAGGC
TGCTGTGCCAGCCTGGCCAGCCTGCGTTTGGTCGCAGCCTTGTTTCTCAGCTCTGGGACAAAAACTCAAATCTGCATCTCTGCCCACACCTCCAGTTCCCCCTCCCCGGGTGACTCACAGGCCAAGGA
CAAAGTGGCCTCTTGCTCCCAGGGAGGGTAGGATGTGCTGGTGTAGCCTGTGTACGTCCTAAGCACTGGAGCCCTGCCTCGGCCTAGAGACGCTTAGGGAAACCAGAACACATCAGAGCAATTAGGAG
CCAAGAATGGTGGCCCACGCCTTCAATGCCAGCACTTGGGAGGCAGAGGCAGGCGGATCTCAGTGAATTCGAGACCAACCGGGTCTACAGAATGAGTTCCAGGACAGCCAAGGTTATAAAGACACTGT
CTAAAAACAAAACAAAACAAAAACCCAAATCTGTCAGACCTGCTGCAACTTGAGCCACCTAGGAGGGACTTCCAACCTAAGAAGGATGGTGGGCATGGGGGTGCATCCTACACAGAAGCCATACACAC
CGGCCAGATGTCACACGTCACTTTCCAATTCTGCCCCCACTCCAGGGCTGGCTCCTCCCCCTTCACCCTCCAGGGCTGGCTCCTCCCCCTTCACATTCCAGGGCTGGCTCCTCCCCCTTCACACTCCA
GGGCTGGCTCCTCCCCCTTCACATTCCAGGGCTGGCTCCTCCCCCTTCACACTCCAGGGCTGGCTCTTCCCTCTTCACTGCTTTGTGACTCTGGTTTTTATTTCTGAATAAAAAAAAAAAAATCCCGT
GTGCCATTCCCACTCTCCCAGTGTTGCTATTGTGTGGAATGAGGTCACAGGAGGACGAGTCCTCCACAATAAAAACCTCTCTTTTCCTTTTG

hide sequence

RefSeq Acc Id:

XM_039079812 ⟹ XP_038935740

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,356,101 - 9,411,924 (+)	NCBI
mRatBN7.2	7	8,710,645 - 8,761,239 (+)	NCBI

RefSeq Acc Id:

XM_039079813 ⟹ XP_038935741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,348,218 - 9,411,924 (+)	NCBI
mRatBN7.2	7	8,697,513 - 8,761,239 (+)	NCBI

RefSeq Acc Id:

XM_039079814 ⟹ XP_038935742

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,356,071 - 9,411,924 (+)	NCBI
mRatBN7.2	7	8,710,631 - 8,761,239 (+)	NCBI

RefSeq Acc Id:

XM_039079815 ⟹ XP_038935743

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,356,071 - 9,411,924 (+)	NCBI
mRatBN7.2	7	8,710,631 - 8,761,239 (+)	NCBI


Protein RefSeqs	NP_077052	(Get FASTA)	NCBI Sequence Viewer
	XP_017450559	(Get FASTA)	NCBI Sequence Viewer
	XP_038935740	(Get FASTA)	NCBI Sequence Viewer
	XP_038935741	(Get FASTA)	NCBI Sequence Viewer
	XP_038935742	(Get FASTA)	NCBI Sequence Viewer
	XP_038935743	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA65640	(Get FASTA)	NCBI Sequence Viewer
	AAZ23836	(Get FASTA)	NCBI Sequence Viewer
	AAZ23837	(Get FASTA)	NCBI Sequence Viewer
	CAG9553622	(Get FASTA)	NCBI Sequence Viewer
	EDL89206	(Get FASTA)	NCBI Sequence Viewer
	EDL89207	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000109030
GenBank Protein	P43425	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077052 ⟸ NM_024138
- UniProtKB:	Q45QK4 (UniProtKB/Swiss-Prot), P43425 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL hide sequence

RefSeq Acc Id:	XP_017450559 ⟸ XM_017595070
- Peptide Label:	isoform X1
- UniProtKB:	Q45QK4 (UniProtKB/Swiss-Prot), P43425 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL hide sequence

Ensembl Acc Id:

ENSRNOP00000026893 ⟸ ENSRNOT00000026893

RefSeq Acc Id:	XP_038935741 ⟸ XM_039079813
- Peptide Label:	isoform X1
- UniProtKB:	Q45QK4 (UniProtKB/Swiss-Prot), P43425 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038935742 ⟸ XM_039079814
- Peptide Label:	isoform X1
- UniProtKB:	Q45QK4 (UniProtKB/Swiss-Prot), P43425 (UniProtKB/Swiss-Prot)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P43425-F1-model_v2	AlphaFold	P43425	1-68	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34984	BioCyc
Ensembl Genes	ENSRNOG00000019857	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000110558	ENTREZGENE
Gene3D-CATH	4.10.260.10	UniProtKB/Swiss-Prot
InterPro	G-protein_gamma-like_dom	UniProtKB/Swiss-Prot
	GGL_sf	UniProtKB/Swiss-Prot
	Gprotein-gamma	UniProtKB/Swiss-Prot
KEGG Report	rno:58979	UniProtKB/Swiss-Prot
NCBI Gene	58979	ENTREZGENE
PANTHER	PTHR13809	UniProtKB/Swiss-Prot
Pfam	G-gamma	UniProtKB/Swiss-Prot
PhenoGen	Gng7	PhenoGen
PRINTS	GPROTEING	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_GAMMA	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019857	RatGTEx
RNAcentral	URS00022B3C11	RNACentral
	URS00022B3D33	RNACentral
	URS00022B4A56	RNACentral
	URS00022B79D6	RNACentral
SMART	G_gamma	UniProtKB/Swiss-Prot
	GGL	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48670	UniProtKB/Swiss-Prot
TIGR	TC232398
UniProt	A6K8D6_RAT	UniProtKB/TrEMBL
	GBG7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QK4	ENTREZGENE
UniProt Secondary	Q45QK4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gng7	G protein subunit gamma 7	Gng7	guanine nucleotide binding protein (G protein), gamma 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Gng7	guanine nucleotide binding protein (G protein), gamma 7	Gng7	guanine nucleotide binding protein, gamma 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Gng7	guanine nucleotide binding protein, gamma 7			Name updated	70584	APPROVED

Note Type	Note	Reference
gene_expression	enriched in neurons of neostriatum, nucleus accumbens, and olfactory tubercle	61610
gene_protein	68 amino acids	61610

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)