Tat (tyrosine aminotransferase) - Rat Genome Database

Name: Tat
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tat (tyrosine aminotransferase) Rattus norvegicus

Analyze

Symbol:

Tat

Name:

tyrosine aminotransferase

RGD ID:

3820

Description:

Enables L-tyrosine:2-oxoglutarate aminotransferase activity and amino acid binding activity. Involved in several processes, including response to dexamethasone; response to mercury ion; and response to oxidative stress. Human ortholog(s) of this gene implicated in tyrosinemia and tyrosinemia type II. Orthologous to human TAT (tyrosine aminotransferase); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 11-deoxycorticosterone.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

L-tyrosine:2-oxoglutarate aminotransferase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAT (tyrosine aminotransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tat (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tat (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TAT (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAT (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tat (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAT (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TAT (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tat (tyrosine aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tat (tyrosine aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TAT (tyrosine aminotransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tat (tyrosine aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1461	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tatn-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	37,947,153 - 37,957,717 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	37,947,112 - 37,958,031 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	44,759,466 - 44,770,043 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	45,412,802 - 45,423,379 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	47,722,404 - 47,732,988 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	41,675,639 - 41,686,195 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	41,675,355 - 41,686,229 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	52,499,259 - 52,509,759 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	39,854,163 - 39,865,060 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	39,859,002 - 39,870,255 (+)	NCBI
Celera	19	37,350,682 - 37,361,246 (+)	NCBI		Celera
RH 3.4 Map	19	448.1	RGD
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 6 (ISO)

genetic disease (ISO)

microcephaly (ISO)

tyrosinemia (ISO)

tyrosinemia type II (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-colchicine (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

11-deoxycorticosterone (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-nitrofluorene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-methyl-4'-dimethylaminoazobenzene (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

5-azacytidine (ISO)

5-fluorouracil (ISO)

acephate (EXP)

acetic acid (ISO)

actinomycin D (EXP,ISO)

aflatoxin B1 (EXP,ISO)

aldosterone (EXP)

ammonium chloride (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

arsenite(3-) (EXP)

arsenous acid (ISO)

atropine (EXP)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beryllium sulfate (EXP)

bisphenol A (EXP,ISO)

bosentan (ISO)

bromobenzene (EXP)

bromochloroacetic acid (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

Calcimycin (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (EXP)

ciguatoxin CTX1B (ISO)

cisplatin (EXP)

clofibrate (ISO)

corn oil (EXP)

corticosterone (EXP)

cortisol (EXP,ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

cypermethrin (EXP)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

diazepam (EXP)

dichlorvos (EXP)

diethylstilbestrol (EXP)

disulfiram (EXP)

ebselen (EXP)

epoxiconazole (ISO)

ethanol (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glyphosate (EXP)

imidacloprid (EXP)

inulin (ISO)

ketoconazole (ISO)

lead diacetate (EXP,ISO)

leflunomide (ISO)

mercury atom (EXP)

mercury(0) (EXP)

methapyrilene (EXP)

methoxychlor (EXP)

methylprednisolone aceponate (ISO)

miconazole (EXP,ISO)

mifepristone (EXP,ISO)

mirex (EXP)

mometasone furoate (ISO)

monosodium L-glutamate (ISO)

Muraglitazar (EXP)

N,N-diethyl-m-toluamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

nimesulide (EXP)

O-methyleugenol (ISO)

ortho-Aminoazotoluene (ISO)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP,ISO)

phorbol 13-acetate 12-myristate (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

prednisolone (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP,ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sphingosine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

thiabendazole (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

tolylfluanid (EXP)

Triptolide (EXP,ISO)

triptonide (ISO)

troglitazone (EXP)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP)

trovafloxacin (ISO)

urethane (ISO)

ursodeoxycholic acid (EXP)

valdecoxib (EXP)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

2-oxoglutarate metabolic process (ISO)

amino acid metabolic process (IDA)

biosynthetic process (IEA)

glutamate metabolic process (ISO,ISS)

L-phenylalanine catabolic process (IBA,IEA)

response to dexamethasone (IEP)

response to glucocorticoid (IDA)

response to mercury ion (IDA)

response to organic cyclic compound (IDA)

response to oxidative stress (IDA)

tyrosine catabolic process (IBA,ISO,ISS)

Molecular Function

amino acid binding (IDA)

identical protein binding (ISO)

L-tyrosine:2-oxoglutarate aminotransferase activity (IBA,IDA,ISO,ISS)

protein binding (ISO)

pyridoxal phosphate binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

alkaptonuria pathway (ISO)

cysteine and methionine metabolic pathway (IEA)

disulfiram pharmacodynamics pathway (ISO)

dopamine beta-hydroxylase deficiency pathway (ISO)

forkhead class A signaling pathway (ISO)

hawkinsinuria pathway (ISO)

phenylalanine metabolic pathway (IEA)

phenylalanine, tyrosine and tryptophan biosynthetic pathway (IEA)

phenylketonuria pathway (ISO)

tyrosine metabolic pathway (IEA,ISO)

tyrosinemia type I pathway (ISO)

tyrosinemia type II pathway (ISO)

tyrosinemia type III pathway (ISO)

ubiquinone biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Structural and immunochemical properties of rat liver tyrosine aminotransferase.	Dietrich JB, etal., Biochimie 1988 May;70(5):673-9.
2.	Mercury influences rat liver tyrosine aminotransferase activity and induction by dexamethasone.	Dundjerski J, etal., J Appl Toxicol. 2006 Mar-Apr;26(2):187-90.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Complete complementary DNA of rat tyrosine aminotransferase messenger RNA. Deduction of the primary structure of the enzyme.	Grange T, etal., J Mol Biol 1985 Jul 20;184(2):347-50.
6.	The structure of tyrosine aminotransferase. Evidence for domains involved in catalysis and enzyme turnover.	Hargrove JL, etal., J Biol Chem 1989 Jan 5;264(1):45-53.
7.	Role of Glucocorticoid Receptor and Pregnane X Receptor in Dexamethasone Induction of Rat Hepatic Aryl Hydrocarbon Receptor Nuclear Translocator and NADPH-Cytochrome P450 Oxidoreductase.	Hunter SR, etal., Drug Metab Dispos. 2017 Feb;45(2):118-129. doi: 10.1124/dmd.116.073833. Epub 2016 Nov 16.
8.	Xenobiotics and the glucocorticoid receptor: additive antagonistic effects on tyrosine aminotransferase activity in rat hepatoma cells.	Johansson M, etal., Basic Clin Pharmacol Toxicol. 2005 Apr;96(4):309-15.
9.	[Glucose-fatty acids cycle in cobalt chloride-induced oxidative stress in rats]	Kaliman PA and Okhrimenko SM, Ukr Biokhim Zh. 2005 Mar-Apr;77(2):154-8.
10.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
11.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Subcellular distribution of tyrosine aminotransferase in rat brain.	Miller JE and Litwack G, Arch Biochem Biophys. 1969 Oct;134(1):149-59.
14.	Point mutations in the tyrosine aminotransferase gene in tyrosinemia type II.	Natt E, etal., Proc Natl Acad Sci U S A. 1992 Oct 1;89(19):9297-301.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
19.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
20.	GOA pipeline	RGD automated data pipeline
21.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Isolation and characterization of the rat tyrosine aminotransferase gene.	Shinomiya T, etal., Proc Natl Acad Sci U S A 1984 Mar;81(5):1346-50.
24.	Involvement of conserved asparagine and arginine residues from the N-terminal region in the catalytic mechanism of rat liver and Trypanosoma cruzi tyrosine aminotransferases.	Sobrado VR, etal., Protein Sci. 2003 May;12(5):1039-50.
25.	Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.	Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34

Additional References at PubMed

PMID:1299072	PMID:1682164	PMID:1983704	PMID:7999802	PMID:12477932	PMID:14651853	PMID:17170234	PMID:21153519	PMID:25502805	PMID:31515488

Genomics

Comparative Map Data

Tat
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	37,947,153 - 37,957,717 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	37,947,112 - 37,958,031 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	44,759,466 - 44,770,043 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	45,412,802 - 45,423,379 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	47,722,404 - 47,732,988 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	41,675,639 - 41,686,195 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	41,675,355 - 41,686,229 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	52,499,259 - 52,509,759 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	39,854,163 - 39,865,060 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	39,859,002 - 39,870,255 (+)	NCBI
Celera	19	37,350,682 - 37,361,246 (+)	NCBI		Celera
RH 3.4 Map	19	448.1	RGD
Cytogenetic Map	19	q12	NCBI

TAT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	71,565,660 - 71,577,092 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	71,565,660 - 71,577,092 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	71,599,563 - 71,610,995 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	70,158,255 - 70,168,496 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	70,158,254 - 70,168,496	NCBI
Celera	16	55,916,606 - 55,926,850 (-)	NCBI		Celera
Cytogenetic Map	16	q22.2	NCBI
HuRef	16	57,368,735 - 57,378,980 (-)	NCBI		HuRef
CHM1_1	16	73,013,576 - 73,023,820 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	77,382,852 - 77,394,286 (-)	NCBI		T2T-CHM13v2.0

Tat
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	110,712,710 - 110,726,436 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	110,717,069 - 110,726,435 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	109,986,078 - 109,999,804 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	109,990,437 - 109,999,803 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	112,514,336 - 112,523,704 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	112,879,586 - 112,888,930 (+)	NCBI		MGSCv36	mm8
Celera	8	114,212,364 - 114,221,732 (+)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	57.38	NCBI

Tat
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	4,276,953 - 4,287,627 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	4,278,083 - 4,287,535 (-)	NCBI	ChiLan1.0	ChiLan1.0

TAT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	88,514,074 - 88,524,846 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	53,434,028 - 53,443,624 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	71,402,560 - 71,414,013 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	71,404,399 - 71,413,886 (-)	Ensembl	panpan1.1		panPan2

TAT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	77,365,589 - 77,378,474 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	77,366,138 - 77,378,419 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	77,327,228 - 77,340,137 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	77,804,675 - 77,817,578 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	77,804,680 - 77,817,500 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	77,624,765 - 77,637,663 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	77,447,892 - 77,460,816 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	77,946,897 - 77,959,805 (-)	NCBI		UU_Cfam_GSD_1.0

Tat
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	37,389,275 - 37,399,429 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	22,189,728 - 22,199,672 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	22,190,282 - 22,199,398 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	14,570,589 - 14,583,177 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	14,571,311 - 14,583,203 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	14,064,566 - 14,076,459 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	54,695,342 - 54,749,291 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	54,693,458 - 54,705,082 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	17,503,474 - 17,512,808 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tat
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	13,790,440 - 13,803,202 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	13,793,593 - 13,803,227 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tat
47 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	102
Interacting mature miRNAs:	119
Transcripts:	ENSRNOT00000022721
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	19	33838214	55283146	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat

Markers in Region

D19Mgh2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,955,789 - 37,955,932 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,677,424 - 41,677,566	NCBI	Rnor6.0
Rnor_5.0	19	52,501,044 - 52,501,186	UniSTS	Rnor5.0
RGSC_v3.4	19	39,863,132 - 39,863,275	RGD	RGSC3.4
RGSC_v3.4	19	39,863,133 - 39,863,275	UniSTS	RGSC3.4
RGSC_v3.1	19	39,868,013 - 39,868,156	RGD
Celera	19	37,359,319 - 37,359,461	UniSTS
RH 3.4 Map	19	442.9	RGD
RH 3.4 Map	19	442.9	UniSTS
RH 2.0 Map	19	488.7	RGD
FHH x ACI Map	19	30.2099	RGD
Cytogenetic Map	19	q11-q12	UniSTS

D19Wox4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,947,207 - 37,947,399 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,685,949 - 41,686,140	NCBI	Rnor6.0
Rnor_5.0	19	52,509,513 - 52,509,704	UniSTS	Rnor5.0
RGSC_v3.4	19	39,854,217 - 39,854,409	RGD	RGSC3.4
RGSC_v3.4	19	39,854,218 - 39,854,409	UniSTS	RGSC3.4
RGSC_v3.1	19	39,859,098 - 39,859,290	RGD
Celera	19	37,350,737 - 37,350,926	UniSTS
RH 3.4 Map	19	441.8	UniSTS
RH 3.4 Map	19	441.8	RGD
RH 2.0 Map	19	482.6	RGD
Cytogenetic Map	19	q11-q12	UniSTS

D19Wox6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,937,168 - 37,937,490 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,695,858 - 41,696,179	NCBI	Rnor6.0
Rnor_5.0	19	52,519,422 - 52,519,743	UniSTS	Rnor5.0
RGSC_v3.4	19	39,844,178 - 39,844,500	RGD	RGSC3.4
RGSC_v3.4	19	39,844,179 - 39,844,500	UniSTS	RGSC3.4
RGSC_v3.1	19	39,849,059 - 39,849,381	RGD
Celera	19	37,340,698 - 37,341,019	UniSTS
RH 3.4 Map	19	431.7	UniSTS
RH 3.4 Map	19	431.7	RGD
RH 2.0 Map	19	471.8	RGD
Cytogenetic Map	19	q11-q12	UniSTS

D19Wox5

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	19	454.5	UniSTS
RH 3.4 Map	19	454.5	RGD
Cytogenetic Map	19	q11-q12	UniSTS

D19Arb5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,947,112 - 37,947,409 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,685,939 - 41,686,235	NCBI	Rnor6.0
Rnor_5.0	19	52,509,503 - 52,509,799	UniSTS	Rnor5.0
RGSC_v3.4	19	39,854,122 - 39,854,419	RGD	RGSC3.4
RGSC_v3.4	19	39,854,123 - 39,854,419	UniSTS	RGSC3.4
RGSC_v3.1	19	39,859,003 - 39,859,300	RGD
Celera	19	37,350,642 - 37,350,936	UniSTS
Cytogenetic Map	19	q11-q12	UniSTS

Tat

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,947,222 - 37,947,402 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,685,946 - 41,686,125	NCBI	Rnor6.0
Rnor_5.0	19	52,509,510 - 52,509,689	UniSTS	Rnor5.0
RGSC_v3.4	19	39,854,233 - 39,854,412	UniSTS	RGSC3.4
Celera	19	37,350,752 - 37,350,929	UniSTS
Cytogenetic Map	19	q11-q12	UniSTS

RH94607

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	37,957,511 - 37,957,647 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	41,675,709 - 41,675,844	NCBI	Rnor6.0
Rnor_5.0	19	52,499,329 - 52,499,464	UniSTS	Rnor5.0
RGSC_v3.4	19	39,864,855 - 39,864,990	UniSTS	RGSC3.4
Celera	19	37,361,041 - 37,361,176	UniSTS
RH 3.4 Map	19	448.1	UniSTS
Cytogenetic Map	19	q11-q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			23	23		23
Low			2				2	2	2	3	4	3	2
Below cutoff	1	8	27	14	16	14	5	5	19	20	24	8	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ010709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M18340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M29576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X02741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000022721 ⟹ ENSRNOP00000022721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	37,947,112 - 37,958,031 (+)	Ensembl
Rnor_6.0 Ensembl	19	41,675,355 - 41,686,229 (-)	Ensembl

RefSeq Acc Id:

NM_012668 ⟹ NP_036800

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	37,947,153 - 37,957,717 (+)	NCBI
Rnor_6.0	19	41,675,639 - 41,686,195 (-)	NCBI
Rnor_5.0	19	52,499,259 - 52,509,759 (-)	NCBI
RGSC_v3.4	19	39,854,163 - 39,865,060 (+)	RGD
Celera	19	37,350,682 - 37,361,246 (+)	RGD

Sequence:

show sequence

TGCTGGGAGGCTGCTTTGCCTGGACTTGGAAGGCTTCGAGAGGCATGGACTCCTACGTGATTCA
GACGGATGTCGACGACAGCTTGTCCTCAGTTCTGGATGTGCATGTCAATATTGGTGGGAGAAAC
TCGGTACAAGGAAGAAAGAAAGGCAGGAAGGCCAGATGGGACGTGAGACCCTCTGACATGTCCA
ATAAGACCTTCAATCCCATCCGAGCCATCGTGGACAACATGAAGGTGCAGCCCAATCCGAACAA
GACCGTGATTTCTCTGTCAATTGGGGACCCTACTGTGTTTGGGAACCTGCCTACAGACCCTGAA
GTTACCCAAGCCATGAAAGATGCCCTGGACTCGGGGAAGTACAATGGCTATGCCCCGTCCATCG
GCTACCTATCCAGTCGGGAGGAGGTCGCTTCTTACTACCACTGTCATGAGGCTCCTCTGGAAGC
TAAGGATGTCATTCTGACAAGCGGCTGCAGTCAGGCCATTGAGCTATGTCTAGCTGTGTTGGCC
AATCCTGGACAAAACATCCTCATTCCAAGGCCCGGGTTTTCCCTCTATAGGACTTTGGCTGAGT
CTATGGGAATTGAGGTCAAGCTCTACAATCTCCTGCCCGAGAAGTCTTGGGAAATTGACCTAAA
ACAACTGGAATCTCTGATCGATGAAAAAACAGCGTGTCTTGTTGTCAACAACCCATCCAATCCC
TGTGGCTCCGTGTTCAGTAAGCGGCACCTTCAGAAGATTTTGGCAGTGGCTGAAAGGCAGTGTG
TCCCCATCTTAGCTGACGAGATCTATGGTGACATGGTGTTTTCAGATTGCAAATACGAACCACT
GGCCAACCTCAGCACCAATGTTCCCATCCTGTCCTGTGGTGGGCTGGCCAAGCGCTGGCTGGTT
CCTGGCTGGAGGTTGGGCTGGATCCTCATTCATGATCGAAGAGACATTTTTGGCAATGAGATTC
GAGACGGGCTGGTGAAACTGAGTCAGCGGATCCTGGGACCATGCACCATAGTCCAGGGTGCTCT
GAAGAGCATCCTTCAGCGAACCCCTCAGGAGTTCTATCACGACACGTTAAGCTTCCTCAAGTCC
AATGCGGACCTCTGCTATGGGGCACTGGCTGCCATCCCTGGACTCCAGCCGGTCCGCCCTTCTG
GAGCCATGTACCTTATGGTGGGAATTGAGATGGAGCATTTCCCGGAATTCGAGAACGACGTGGA
GTTCACAGAGCGGTTGATTGCGGAGCAGGCTGTCCACTGTCTCCCAGCAACGTGCTTCGAGTAC
CCAAATTTCTTCCGAGTGGTCATCACAGTCCCCGAGGTGATGATGCTGGAGGCTTGTAGCCGGA
TCCAGGAGTTCTGTGAACAGCACTACCACTGTGCTGAAGGCAGCCAGGAGGAGTGTGACAAATA
AGCCCTCACCCGTCCTCCTGAAGACATGTCCCACGCAAGGACGGTTGGACTGGACCGCTCCTCC
TCAGGGAGCCAAATGTCTCTGATGGGAGAGGAACCTCTAAAGCACCGCATGAAGACTTGAAGAT
CATTTCTCCTTCCCCCAGTTTCACCCAACGCACGCCTGGAAACCCAGACCCCTCCCTACTCAGT
TCTGCTGGAGCCATGAGCTCACTGCCCCCCACCCCCCACTTCCTTATCCTGAGGGTATCAGACC
AATTTACCAGAAAGAAGCTGGGCCAAGAAAAGAGAGAGCTCAGGATGAGAGAAGCAGAAGACGG
AGGATGCCTCTCCCACCCATTTCCTCGTGCTGACATCCTCTTCAGTCAGGTCGGAAGTCACCTC
AGTTGCTGCCTCACTTCAGGCAAACCTCACTCCTCGTGGTACAGCTACACCAGAGAGAAGTCGA
GGACTTGTGAATTCAGTTAATTGTATTCTAAACACATCAGGAAACTTGATGTTTAAAGGATCCC
TGACAGAATTTTTATTTTTATTTTTTGTAAAGGATTATTTTGCGGTGCAAATAAATACCAGCTT
CCTAAACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036800	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42203	(Get FASTA)	NCBI Sequence Viewer
	AAH89813	(Get FASTA)	NCBI Sequence Viewer
	CAA09309	(Get FASTA)	NCBI Sequence Viewer
	CAA26519	(Get FASTA)	NCBI Sequence Viewer
	EDL92520	(Get FASTA)	NCBI Sequence Viewer
	EDL92521	(Get FASTA)	NCBI Sequence Viewer
	EDL92522	(Get FASTA)	NCBI Sequence Viewer
	EDL92523	(Get FASTA)	NCBI Sequence Viewer
	P04694	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036800 ⟸ NM_012668

- UniProtKB:

Q5EBB6 (UniProtKB/Swiss-Prot), P04694 (UniProtKB/Swiss-Prot), A6IZ42 (UniProtKB/TrEMBL), Q9QWS4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSYVIQTDVDDSLSSVLDVHVNIGGRNSVQGRKKGRKARWDVRPSDMSNKTFNPIRAIVDNMK
VQPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHC
HEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEK
SWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFS
DCKYEPLANLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPC
TIVQGALKSILQRTPQEFYHDTLSFLKSNADLCYGALAAIPGLQPVRPSGAMYLMVGIEMEHFP
EFENDVEFTERLIAEQAVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQHYHCAEGS
QEECDK

hide sequence

RefSeq Acc Id:

ENSRNOP00000022721 ⟸ ENSRNOT00000022721

Protein Domains

Aminotransferase class I/classII Tyrosine aminotransferase ubiquitination region

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04694-F1-model_v2	AlphaFold	P04694	1-454	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3820	AgrOrtholog
BioCyc Gene	G2FUF-5702	BioCyc
BioCyc Pathway	PWY-5886 [3-(4-hydroxyphenyl)pyruvate biosynthesis]	BioCyc
	TYRFUMCAT-PWY [L-tyrosine degradation I]	BioCyc
Ensembl Genes	ENSRNOG00000016348	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000022721	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000022721	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.640.10	UniProtKB/Swiss-Prot
	3.90.1150.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Type I PLP-dependent aspartate aminotransferase-like (Major domain)	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7372826	IMAGE-MGC_LOAD
InterPro	Aminotransferase_I/II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NHTrfase_class1_PyrdxlP-BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_dom1	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_major	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_small	UniProtKB/TrEMBL
	Tyr_aminoTrfase_ubiquitination	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TyrNic_aminoTrfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tyrosine_aminoTrfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24813	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108738	IMAGE-MGC_LOAD
NCBI Gene	24813	ENTREZGENE
PANTHER	TYROSINE AMINOTRANSFERASE	UniProtKB/Swiss-Prot
	TYROSINE AMINOTRANSFERASE	UniProtKB/Swiss-Prot
	TYROSINE AMINOTRANSFERASE	UniProtKB/TrEMBL
	TYROSINE AMINOTRANSFERASE	UniProtKB/TrEMBL
Pfam	Aminotran_1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TAT_ubiq	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tat	PhenoGen
PIRSF	Tyr_transaminase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	AA_TRANSFER_CLASS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PLP-dependent transferases	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6IZ42	ENTREZGENE, UniProtKB/TrEMBL
	A6IZ43_RAT	UniProtKB/TrEMBL
	A6IZ44_RAT	UniProtKB/TrEMBL
	A6IZ45_RAT	UniProtKB/TrEMBL
	ATTY_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5EBB6	ENTREZGENE
	Q9QWS4	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	Q5EBB6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Tat	tyrosine aminotransferase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)