Slc18a1 (solute carrier family 18 member A1)

Gene: Slc18a1 (solute carrier family 18 member A1) Rattus norvegicus

Analyze

Symbol:

Slc18a1

Name:

solute carrier family 18 member A1

RGD ID:

3693

Description:

Enables enzyme binding activity; monoamine:proton antiporter activity; and serotonin:sodium:chloride symporter activity. Involved in several processes, including cellular response to lithium ion; positive regulation of dopamine secretion; and serotonin uptake. Predicted to be located in endoplasmic reticulum membrane and secretory granule membrane. Predicted to be active in synaptic vesicle membrane and terminal bouton. Human ortholog(s) of this gene implicated in bipolar disorder and schizophrenia. Orthologous to human SLC18A1 (solute carrier family 18 member A1); PARTICIPATES IN Parkinson's disease pathway; INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CGAT; chromaffin granule amine transporter; LOC684870; similar to solute carrier family 18 (vesicular monoamine), member 1; solute carrier family 18 (vesicular monoamine transporter), member 1; solute carrier family 18 (vesicular monoamine), member 1; solute carrier family 18 member 1; solute carrier family 18, member 1; Solute carrier family18 (vesicular monoamine) member 1 (chromaffin granule amine transporter); VAT1; vesicular amine transporter 1; vesicular monoamine transporter 1; VMAT-1; VMAT1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC18A1 (solute carrier family 18 member A1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Slc18a1 (solute carrier family 18 (vesicular monoamine), member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc18a1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC18A1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC18A1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc18a1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC18A1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC18A1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc18a1 (solute carrier family 18 member A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Slc18a1 (solute carrier family 18 (vesicular monoamine), member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC18A1 (solute carrier family 18 member A1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cat-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Vmat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc18a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	slc18a2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	25,408,485 - 25,453,786 (+)	NCBI		GRCr8
mRatBN7.2	16	20,653,268 - 20,687,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	20,653,508 - 20,687,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	24,022,654 - 24,055,924 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	27,452,714 - 27,485,111 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	23,387,959 - 23,421,230 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	22,358,646 - 22,395,183 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	22,361,998 - 22,395,183 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	22,256,523 - 22,289,704 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	22,356,304 - 22,389,827 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	22,356,297 - 22,389,825 (+)	NCBI
Celera	16	20,629,165 - 20,846,643 (+)	NCBI		Celera
RH 3.4 Map	16	253.67	RGD
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bipolar disorder (ISO)

genetic disease (ISO)

hereditary spastic paraplegia 53 (ISO)

schizophrenia (ISO)

von Hippel-Lindau disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-noradrenaline (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

2-phenylethylamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

9,10-dimethoxy-3-isobutyl-1,3,4,6,7,11b-hexahydro-2H-pyrido[2,1-a]isoquinolin-2-one (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cannabidiol (ISO)

cannabigerol (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

dextran sulfate (ISO)

diazinon (EXP)

dichlorine (EXP)

dichloroacetic acid (ISO)

dieldrin (EXP)

dopamine (ISO)

furan (EXP)

gentamycin (EXP)

GW 4064 (ISO)

histamine (ISO)

inulin (ISO)

lead diacetate (EXP)

methimazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (EXP)

ozone (EXP)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (ISO)

pirinixic acid (ISO)

propanal (ISO)

reserpine (ISO)

resveratrol (ISO)

serotonin (ISO)

sodium arsenite (ISO)

sodium atom (EXP)

testosterone (EXP)

tetrabenazine (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aminergic neurotransmitter loading into synaptic vesicle (IBA,IEA)

cellular response to lithium ion (IEP)

dopamine uptake (ISO)

negative regulation of serotonin uptake (IMP)

norepinephrine uptake (ISO)

positive regulation of dopamine secretion (IMP)

proton transmembrane transport (IEA)

serotonin uptake (IDA,IEA,ISO)

transmembrane transport (IEA)

xenobiotic transport (IEA)

Cellular Component

endoplasmic reticulum membrane (ISO)

secretory granule membrane (ISO)

synapse (ISO)

synaptic vesicle membrane (IBA,IEA)

terminal bouton (IBA,IEA)

Molecular Function

enzyme binding (IPI)

monoamine:proton antiporter activity (IDA,IEA,ISO)

protein binding (ISO)

serotonin:sodium:chloride symporter activity (IBA,IDA,IEA)

transmembrane transporter activity (IEA)

xenobiotic transmembrane transporter activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	The first luminal domain of vesicular monoamine transporters mediates G-protein-dependent regulation of transmitter uptake.	Brunk I, etal., J Biol Chem. 2006 Nov 3;281(44):33373-85. Epub 2006 Aug 22.
2.	Ca2+-dependent activator proteins of secretion promote vesicular monoamine uptake.	Brunk I, etal., J Biol Chem. 2009 Jan 9;284(2):1050-6. Epub 2008 Nov 13.
3.	A biochemical and functional protein complex involving dopamine synthesis and transport into synaptic vesicles.	Cartier EA, etal., J Biol Chem. 2010 Jan 15;285(3):1957-66. Epub 2009 Nov 10.
4.	Lithium ions Up-regulate mRNAs encoding dense-core vesicle proteins in nerve growth factor-differentiated PC12 cells.	Cordeiro ML, etal., J Neurochem. 2000 Dec;75(6):2622-5.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Different expression of catecholamine transporters in phaeochromocytomas from patients with von Hippel-Lindau syndrome and multiple endocrine neoplasia type 2.	Huynh TT, etal., Eur J Endocrinol. 2005 Oct;153(4):551-63.
8.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.	A cDNA that suppresses MPP+ toxicity encodes a vesicular amine transporter.	Liu Y, etal., Cell 1992 Aug 21;70(4):539-51.
10.	Association between polymorphisms in the vesicular monoamine transporter 1 gene (VMAT1/SLC18A1) on chromosome 8p and schizophrenia.	Lohoff FW, etal., Neuropsychobiology. 2008;57(1-2):55-60. Epub 2008 May 2.
11.	Variations in the vesicular monoamine transporter 1 gene (VMAT1/SLC18A1) are associated with bipolar i disorder.	Lohoff FW, etal., Neuropsychopharmacology. 2006 Dec;31(12):2739-47. Epub 2006 Aug 23.
12.	Vesicular monoamine transporter 1 mediates dopamine secretion in rat proximal tubular cells.	Maurel A, etal., Am J Physiol Renal Physiol. 2007 May;292(5):F1592-8. Epub 2007 Jan 23.
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	The chromaffin granule and synaptic vesicle amine transporters differ in substrate recognition and sensitivity to inhibitors.	Peter D, etal., J Biol Chem. 1994 Mar 11;269(10):7231-7.
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:12534970	PMID:22253933	PMID:23201251	PMID:31955909

Genomics

Comparative Map Data

Slc18a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	25,408,485 - 25,453,786 (+)	NCBI		GRCr8
mRatBN7.2	16	20,653,268 - 20,687,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	20,653,508 - 20,687,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	24,022,654 - 24,055,924 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	27,452,714 - 27,485,111 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	23,387,959 - 23,421,230 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	22,358,646 - 22,395,183 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	22,361,998 - 22,395,183 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	22,256,523 - 22,289,704 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	22,356,304 - 22,389,827 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	22,356,297 - 22,389,825 (+)	NCBI
Celera	16	20,629,165 - 20,846,643 (+)	NCBI		Celera
RH 3.4 Map	16	253.67	RGD
Cytogenetic Map	16	p14	NCBI

SLC18A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	20,144,855 - 20,183,136 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	20,144,855 - 20,183,206 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	20,002,366 - 20,040,647 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	20,046,652 - 20,084,997 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	20,046,651 - 20,084,997	NCBI
Celera	8	18,964,997 - 19,003,346 (-)	NCBI		Celera
Cytogenetic Map	8	p21.3	NCBI
HuRef	8	18,542,580 - 18,580,897 (-)	NCBI		HuRef
CHM1_1	8	20,204,176 - 20,242,504 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	20,409,985 - 20,448,250 (-)	NCBI		T2T-CHM13v2.0

Slc18a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	69,490,360 - 69,547,951 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	69,490,363 - 69,541,887 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	69,037,708 - 69,089,238 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	69,037,711 - 69,089,235 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	71,561,607 - 71,613,121 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	71,966,697 - 72,018,211 (-)	NCBI		MGSCv36	mm8
Celera	8	71,585,811 - 71,639,074 (-)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	33.88	NCBI

Slc18a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	43,821,296 - 43,848,399 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	43,821,978 - 43,848,403 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC18A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	38,626,188 - 38,662,488 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	14,351,749 - 14,388,069 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	19,369,843 - 19,408,412 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	16,318,744 - 16,353,708 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	16,318,744 - 16,353,708 (-)	Ensembl	panpan1.1		panPan2

SLC18A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	36,859,047 - 36,904,057 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	36,872,636 - 36,904,056 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	37,453,565 - 37,498,544 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	37,085,789 - 37,130,930 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	37,105,537 - 37,130,929 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	37,021,486 - 37,066,607 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	36,869,997 - 36,915,036 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	37,038,820 - 37,083,968 (+)	NCBI		UU_Cfam_GSD_1.0

Slc18a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	14,299,001 - 14,321,190 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	4,249,821 - 4,271,379 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936555	4,249,821 - 4,271,379 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC18A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	4,243,557 - 4,275,243 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	4,243,553 - 4,279,341 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	4,278,115 - 4,313,822 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC18A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	18,214,703 - 18,250,025 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	18,214,701 - 18,249,731 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	24,002,943 - 24,037,546 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc18a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	15,864,204 - 15,894,529 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	15,863,410 - 15,894,958 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc18a1
240 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	58
Count of miRNA genes:	50
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000016193
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat

Markers in Region

RH94391

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	20,686,870 - 20,687,031 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	22,395,003 - 22,395,163	NCBI	Rnor6.0
Rnor_5.0	16	22,289,524 - 22,289,684	UniSTS	Rnor5.0
RGSC_v3.4	16	22,389,647 - 22,389,807	UniSTS	RGSC3.4
Celera	16	20,846,463 - 20,846,623	UniSTS
RH 3.4 Map	16	253.67	UniSTS
Cytogenetic Map	16	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		8								1
Low	1	24	14	14		14			74	6	25
Below cutoff		17	15	13	4	13	2	2		29	13	5	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006252993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010058278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY168444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M97380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016193 ⟹ ENSRNOP00000016193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	20,653,508 - 20,687,051 (+)	Ensembl
Rnor_6.0 Ensembl	16	22,361,998 - 22,395,183 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106291 ⟹ ENSRNOP00000082299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	20,653,508 - 20,687,051 (+)	Ensembl

RefSeq Acc Id:

NM_013152 ⟹ NP_037284

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,420,247 - 25,453,786 (+)	NCBI
mRatBN7.2	16	20,653,512 - 20,687,051 (+)	NCBI
Rnor_6.0	16	22,362,002 - 22,395,183 (+)	NCBI
Rnor_5.0	16	22,256,523 - 22,289,704 (+)	NCBI
RGSC_v3.4	16	22,356,304 - 22,389,827 (+)	RGD
Celera	16	20,629,165 - 20,846,643 (+)	NCBI

Sequence:

show sequence

CACATCCACTTTCAGAGAACAGAGTCTCTGCTGTCTTGCCAACGGCTGCTCCTTCCTCTCTGAG
TGCCTCACATCAAGATAAGCTAGAAGTGAGCTTCACTGGACCAGGCAGACTTCTTCTCCTATAA
AGGTGACAGAAGACCACATTTGTCAAGGGGTCTTCCTAAGCCCTGGGAGGAGAAGCCCCCACCA
TCTCACTCCCTACCCAGCCCAGCCTCCTGCAGCCCTTGCCATGCTCCAGGTTGTTCTGGGTGCT
CCTCAGCGGTTGCTGAAGGAAGGAAGGCAGTCCCGCAAGCTGGTGCTGGTGGTGGTGTTCGTGG
CTCTGCTTCTGGACAACATGCTGCTCACTGTGGTGGTGCCCATTGTGCCCACCTTCCTGTACGC
GACAGAGTTCAAAGACAGCAACTCTTCTCTGCATAGGGGTCCTTCTGTAAGCTCCCAGCAAGCT
CTCACCTCTCCTGCCTTCTCTACCATATTCTCCTTCTTTGACAACACCACCACAACTGTAGAAG
AACATGTACCCTTCCGTGTAACTTGGACAAATGGCACCATCCCTCCTCCAGTCACTGAAGCCAC
CTCAGTACCAAAAAACAACTGCTTGCAAGGGATAGAGTTCTTAGAAGAAGAAAACGTTCGGATT
GGGATTCTATTTGCTTCAAAAGCTTTGATGCAACTTCTGGTCAACCCATTTGTAGGACCTCTTA
CTAACAGGATTGGCTATCACATCCCCATGTTTGTTGGCTTTATGATCATGTTTCTCTCCACACT
AATGTTTGCTTTCTCTGGCACCTATGCCCTGCTATTTGTGGCCCGAACTCTCCAAGGCATTGGA
TCTTCGTTTTCATCTGTTGCAGGACTTGGGATGCTGGCCAGTGTCTATACTGACAACTATGAGA
GAGGGAGAGCCATGGGAATTGCTTTGGGGGGCCTGGCTTTGGGACTTCTGGTGGGAGCACCTTT
CGGAAGTGTGATGTATGAATTTGTGGGCAAGTCCTCACCATTCCTCATCTTGGCCTTCTTGGCA
CTTCTGGATGGAGCTCTCCAACTTTGCATCCTGTGGCCTTCGAAAGTGTCTCCTGAGAGTGCCA
TGGGGACTCCGCTTTTGACGCTTCTCAAAGACCCTTACATCCTGGTAGCAGCAGGTTCCATCTG
CTTGGCCAACATGGGTGTCGCCATACTAGAGCCCACGCTGCCCATCTGGATGATGCAGACCATG
TGCTCCCCCGAGTGGCAGCTAGGTCTGGCTTTCTTGCCTGCTAGTGTGGCCTACCTCATTGGCA
CGAACCTCTTTGGTGTGTTGGCTAACAAGATGGGTCGGTGGCTGTGCTCCCTTGTTGGGATGGT
GGCAGTAGGTATCAGCTTGCTCTGTGTACCTCTGGCTCACAATATTTTTGGTCTTATTGGCCCC
AATGCAGGCCTTGGCTTTGCCATAGGAATGGTGGATTCCTCTCTGATGCCCATCATGGGATACC
TGGTGGACTTACGCCACACCTCTGTGTATGGGAGTGTCTATGCCATCGCCGATGTGGCCTTTTG
TGTGGGCTTTGCTATTGGCCCATCTACTGGGGGTGTTATCGTACAGGTCATTGGCTTTCCTTGG
CTCATGGTCATCATTGGTACCATCAACATCATTTATGCTCCTCTCTGCTGCTTCCTGCAGAACC
CGCCAGCTAAGGAGGAGAAGCGTGCAATTCTGAGCCAGGAATGCCCCACAGAGACCCAGATGTA
CACAGTCCAGAAGCCCACAAAGGAGTTTCCACTAGGAGAGAACAGCGATGATCCTAGCAGCGGG
GAGTAACTGCGGAGGGCGATATCTGCGCCTCACATCTACAGGGACCAGTCTACTACAGATTCAA
TAATTTTCACTTTCCTCTCCTCCAGGCCACTGCCTTCCTCCCTTCTTATTGATACCTTTCCTTT
ACTCACCTGTAAGTGCAACCCACCACTCTCCCTCTGTGCTTTGACACCACCCATGGCCCACTTT
TTGTGGGAGGACAGTGCTATTTCCTGCCAGGCCAAAGCGAAGCTGATTAAAGCTGAGTTGTGAC
AAGTTCTGCAAGGGGTGACTCACTTCCTGCAGGCAGGACTGAACAATGTGCCTGCGAAATCAGG
GGGACAAATGACAAGCCTGCCTTTCTTCTCTGATTGTTTTTTTTTTTTTGACATATTACCAATA
TGTCCTAAAATTTGACTTGTGTCCTGTGAAATGCTTTCCCCTTATTTTTTCCAGTTTAGCTTCT
ATACATACGGGTTTTTGCTTATTTTATGTGCTAAAATTGTTTACCTTCATTAAGTGAGGCCTTC
CTACTTTCTTCATCGCCCAATTGAGAGGAAATAAACAACTTTCTTAGGCTTGA

hide sequence

RefSeq Acc Id:

XM_039094220 ⟹ XP_038950148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,453,786 (+)	NCBI
mRatBN7.2	16	20,653,268 - 20,687,051 (+)	NCBI

RefSeq Acc Id:

XM_063275099 ⟹ XP_063131169

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,453,786 (+)	NCBI

RefSeq Acc Id:

XM_063275100 ⟹ XP_063131170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,534 - 25,453,786 (+)	NCBI

RefSeq Acc Id:

XM_063275101 ⟹ XP_063131171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,523 - 25,453,786 (+)	NCBI

RefSeq Acc Id:

XM_063275102 ⟹ XP_063131172

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,528 - 25,453,786 (+)	NCBI

RefSeq Acc Id:

XM_063275103 ⟹ XP_063131173

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,453,786 (+)	NCBI

RefSeq Acc Id:

XM_063275104 ⟹ XP_063131174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,443,565 (+)	NCBI

RefSeq Acc Id:

XR_010058277

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,451,602 (+)	NCBI

RefSeq Acc Id:

XR_010058278

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	25,408,485 - 25,449,553 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_037284	(Get FASTA)	NCBI Sequence Viewer
	XP_038950148	(Get FASTA)	NCBI Sequence Viewer
	XP_063131169	(Get FASTA)	NCBI Sequence Viewer
	XP_063131170	(Get FASTA)	NCBI Sequence Viewer
	XP_063131171	(Get FASTA)	NCBI Sequence Viewer
	XP_063131172	(Get FASTA)	NCBI Sequence Viewer
	XP_063131173	(Get FASTA)	NCBI Sequence Viewer
	XP_063131174	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40921	(Get FASTA)	NCBI Sequence Viewer
	AAN75456	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016193
	ENSRNOP00000016193.2
	ENSRNOP00000082299.1
GenBank Protein	Q01818	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037284 ⟸ NM_013152

- UniProtKB:

Q01818 (UniProtKB/Swiss-Prot), F1LSA7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLQVVLGAPQRLLKEGRQSRKLVLVVVFVALLLDNMLLTVVVPIVPTFLYATEFKDSNSSLHRG
PSVSSQQALTSPAFSTIFSFFDNTTTTVEEHVPFRVTWTNGTIPPPVTEATSVPKNNCLQGIEF
LEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLMFAFSGTYALLFV
ARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVGAPFGSVMYEFVGKSSP
FLILAFLALLDGALQLCILWPSKVSPESAMGTPLLTLLKDPYILVAAGSICLANMGVAILEPTL
PIWMMQTMCSPEWQLGLAFLPASVAYLIGTNLFGVLANKMGRWLCSLVGMVAVGISLLCVPLAH
NIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVGFAIGPSTGGVI
VQVIGFPWLMVIIGTINIIYAPLCCFLQNPPAKEEKRAILSQECPTETQMYTVQKPTKEFPLGE
NSDDPSSGE

hide sequence

RefSeq Acc Id:

ENSRNOP00000016193 ⟸ ENSRNOT00000016193

RefSeq Acc Id:	XP_038950148 ⟸ XM_039094220
- Peptide Label:	isoform X2
- UniProtKB:	Q01818 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:

ENSRNOP00000082299 ⟸ ENSRNOT00000106291

RefSeq Acc Id:	XP_063131169 ⟸ XM_063275099
- Peptide Label:	isoform X1
- UniProtKB:	F1LSA7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131173 ⟸ XM_063275103
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063131174 ⟸ XM_063275104
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063131171 ⟸ XM_063275101
- Peptide Label:	isoform X1
- UniProtKB:	F1LSA7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131172 ⟸ XM_063275102
- Peptide Label:	isoform X1
- UniProtKB:	F1LSA7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131170 ⟸ XM_063275100
- Peptide Label:	isoform X1
- UniProtKB:	F1LSA7 (UniProtKB/TrEMBL)

Protein Domains

Major facilitator superfamily (MFS) profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q01818-F1-model_v2	AlphaFold	Q01818	1-521	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3693	AgrOrtholog
BioCyc Gene	G2FUF-11702	BioCyc
Ensembl Genes	ENSRNOG00000011992	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016193	ENTREZGENE
	ENSRNOT00000016193.4	UniProtKB/TrEMBL
	ENSRNOT00000106291.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1250.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	MFS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MFS_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MFS_trans_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Multidrug-R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25693	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25693	ENTREZGENE
PANTHER	CHROMAFFIN GRANULE AMINE TRANSPORTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23506	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MFS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc18a1	PhenoGen
PROSITE	MFS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011992	RatGTEx
Superfamily-SCOP	SSF103473	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC216694
UniProt	A0A8I5ZTW4_RAT	UniProtKB/TrEMBL
	F1LSA7	ENTREZGENE, UniProtKB/TrEMBL
	Q01818	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Slc18a1	solute carrier family 18 member A1	Slc18a1	solute carrier family 18 member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-25	Slc18a1	solute carrier family 18 member 1	Slc18a1	solute carrier family 18 (vesicular monoamine transporter), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc18a1	solute carrier family 18 (vesicular monoamine transporter), member 1	Slc18a1	solute carrier family 18 (vesicular monoamine), member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-04-12	Slc18a1	solute carrier family 18 (vesicular monoamine), member 1	LOC684870	similar to solute carrier family 18 (vesicular monoamine), member 1	Data merged from RGD:1585526	737654	PROVISIONAL
2006-11-19	LOC684870	similar to solute carrier family 18 (vesicular monoamine), member 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Slc18a1	solute carrier family 18 (vesicular monoamine), member 1		solute carrier family 18, member 1	Name updated	1299863	APPROVED
2003-04-09	Slc18a1	solute carrier family 18, member 1		Solute carrier family18 (vesicular monoamine) member 1 (chromaffin granule amine transporter)	Name updated	629478	APPROVED
2002-06-10	Slc18a1	Solute carrier family18 (vesicular monoamine) member 1 (chromaffin granule amine transporter)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed exclusively in adrenal gland	729674

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)