Symbol:
Sftpd
Name:
surfactant protein D
RGD ID:
3667
Description:
Enables identical protein binding activity; lipopolysaccharide binding activity; and monosaccharide binding activity. Involved in several processes, including negative regulation of interleukin-2 production; opsonization; and regulation of phagocytosis. Located in extracellular space and multivesicular body. Biomarker of Coronavirus infectious disease; asthma; bacterial pneumonia; lung disease; and newborn respiratory distress syndrome. Human ortholog(s) of this gene implicated in asthma; lung disease (multiple); respiratory syncytial virus infectious disease; and rhinitis. Orthologous to human SFTPD (surfactant protein D); PARTICIPATES IN surfactant homeostasis pathway; forkhead class A signaling pathway; phagocytosis pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CP4; lung surfactant protein D; PSP-D; pulmonary surfactant protein D; pulmonary surfactant-associated protein D; SP-D; SPD; surfactant associated protein D; surfactant pulmonary-associated protein D; surfactant, pulmonary-associated protein D
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 17,080,575 - 17,093,047 (-) NCBI GRCr8 mRatBN7.2 16 17,046,491 - 17,058,968 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 17,046,483 - 17,059,927 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 17,110,520 - 17,122,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 18,238,920 - 18,251,351 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 17,163,418 - 17,175,790 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 18,753,535 - 18,766,100 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 18,745,458 - 18,766,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 18,621,441 - 18,633,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 16 17,272,045 - 17,284,082 (-) NCBI Celera RH 3.4 Map 16 167.0 RGD Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sftpd Rat 1,2-dichloroethane decreases expression ISO RGD:11287 6480464 ethylene dichloride results in decreased expression of SFTPD mRNA CTD PMID:28960355 Sftpd Rat 17alpha-ethynylestradiol increases expression ISO RGD:11287 6480464 Ethinyl Estradiol results in increased expression of SFTPD mRNA CTD PMID:17942748 Sftpd Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SFTPD mRNA CTD PMID:17557909 Sftpd Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:11287 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SFTPD mRNA CTD PMID:17942748 Sftpd Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:735702 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of SFTPD protein CTD PMID:31675489 Sftpd Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:11287 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SFTPD mRNA CTD PMID:17942748 Sftpd Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:11287 6480464 Tetrachlorodibenzodioxin affects the expression of SFTPD mRNA CTD PMID:21570461 Sftpd Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SFTPD mRNA CTD PMID:18990726 Sftpd Rat 2,4,6-tribromophenol decreases expression ISO RGD:735702 6480464 2,4,6-tribromophenol results in decreased expression of SFTPD mRNA CTD PMID:31675489 Sftpd Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:11287 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of SFTPD mRNA CTD PMID:38648751 Sftpd Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:735702 6480464 tetrabromobisphenol A results in decreased expression of SFTPD protein CTD PMID:31675489 Sftpd Rat 3-methylcholanthrene multiple interactions ISO RGD:11287 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of SFTPD mRNA CTD PMID:23519560 Sftpd Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SFTPD mRNA CTD PMID:30047161 Sftpd Rat acetylsalicylic acid increases expression ISO RGD:735702 6480464 Aspirin results in increased expression of SFTPD mRNA CTD PMID:15456535 Sftpd Rat aflatoxin B1 decreases methylation ISO RGD:735702 6480464 Aflatoxin B1 results in decreased methylation of SFTPD gene CTD PMID:27153756 Sftpd Rat aldehydo-D-glucose decreases expression ISO RGD:735702 6480464 Glucose results in decreased expression of SFTPD mRNA CTD PMID:32942007 Sftpd Rat all-trans-retinoic acid affects expression ISO RGD:735702 6480464 Tretinoin affects the expression of SFTPD mRNA CTD PMID:31600526 Sftpd Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SFTPD mRNA CTD PMID:30047161 Sftpd Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SFTPD mRNA CTD PMID:16483693 Sftpd Rat benzo[a]pyrene decreases expression ISO RGD:11287 6480464 Benzo(a)pyrene results in decreased expression of SFTPD mRNA CTD PMID:22228805 Sftpd Rat benzo[a]pyrene increases expression ISO RGD:11287 6480464 Benzo(a)pyrene results in increased expression of SFTPD mRNA CTD PMID:21964900 Sftpd Rat benzo[a]pyrene affects expression ISO RGD:11287 6480464 Benzo(a)pyrene affects the expression of SFTPD mRNA CTD PMID:22342234 Sftpd Rat benzo[b]fluoranthene increases expression ISO RGD:11287 6480464 benzo(b)fluoranthene results in increased expression of SFTPD mRNA CTD PMID:26377693 Sftpd Rat beryllium sulfate increases expression ISO RGD:735702 6480464 beryllium sulfate results in increased expression of SFTPD mRNA CTD PMID:16314022 Sftpd Rat bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of SFTPD protein CTD PMID:20659490 Sftpd Rat bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of SFTPD protein CTD PMID:33002157 Sftpd Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SFTPD mRNA CTD PMID:25181051|PMID:33296240 Sftpd Rat bisphenol A increases expression ISO RGD:11287 6480464 bisphenol A results in increased expression of SFTPD mRNA CTD PMID:32156529 Sftpd Rat bisphenol A decreases expression ISO RGD:735702 6480464 bisphenol A results in decreased expression of SFTPD protein CTD PMID:31675489 Sftpd Rat bleomycin A2 increases metabolic processing ISO RGD:11287 6480464 Bleomycin results in increased metabolism of SFTPD protein CTD PMID:26526764 Sftpd Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of SFTPD mRNA; Bleomycin results in increased expression of SFTPD more ... CTD PMID:11880309|PMID:25933445 Sftpd Rat bleomycin A2 multiple interactions ISO RGD:11287 6480464 [TNF protein affects the susceptibility to Bleomycin] which affects the expression of SFTPD protein; Bleomycin more ... CTD PMID:26526764|PMID:33647319 Sftpd Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of SFTPD promoter CTD PMID:22457795 Sftpd Rat carbon monoxide multiple interactions ISO RGD:735702 6480464 [[Vehicle Emissions results in increased abundance of Air Pollutants] which results in increased abundance of more ... CTD PMID:37141245 Sftpd Rat carbon nanotube decreases expression ISO RGD:11287 6480464 Nanotubes, Carbon analog results in decreased expression of SFTPD mRNA CTD PMID:25620056 Sftpd Rat CGP 52608 multiple interactions ISO RGD:735702 6480464 CGP 52608 promotes the reaction [RORA protein binds to SFTPD gene] CTD PMID:28238834 Sftpd Rat choline multiple interactions ISO RGD:11287 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Sftpd Rat D-glucose decreases expression ISO RGD:735702 6480464 Glucose results in decreased expression of SFTPD mRNA CTD PMID:32942007 Sftpd Rat decabromodiphenyl ether decreases expression ISO RGD:735702 6480464 decabromobiphenyl ether results in decreased expression of SFTPD protein CTD PMID:31675489 Sftpd Rat dichlorine affects expression ISO RGD:11287 6480464 Chlorine affects the expression of SFTPD protein CTD PMID:24582687 Sftpd Rat dichlorine increases expression ISO RGD:11287 6480464 Chlorine results in increased expression of SFTPD protein CTD PMID:36690086 Sftpd Rat Didecyldimethylammonium increases expression ISO RGD:735702 6480464 didecyldimethylammonium results in increased expression of SFTPD protein CTD PMID:32763356 Sftpd Rat dioxygen multiple interactions EXP 6480464 [Paraquat co-treated with Oxygen] results in increased expression of SFTPD protein CTD PMID:11880309 Sftpd Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of SFTPD mRNA CTD PMID:22911455 Sftpd Rat epoxiconazole increases expression ISO RGD:11287 6480464 epoxiconazole results in increased expression of SFTPD mRNA CTD PMID:35436446 Sftpd Rat folic acid multiple interactions ISO RGD:11287 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Sftpd Rat fumonisin B1 increases expression ISO RGD:11287 6480464 fumonisin B1 results in increased expression of SFTPD mRNA CTD PMID:27376354 Sftpd Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of SFTPD gene CTD PMID:22079235 Sftpd Rat furan increases expression EXP 6480464 furan results in increased expression of SFTPD mRNA CTD PMID:27387713 Sftpd Rat genistein increases expression ISO RGD:11287 6480464 Genistein results in increased expression of SFTPD mRNA CTD PMID:22553218 Sftpd Rat glucose decreases expression ISO RGD:735702 6480464 Glucose results in decreased expression of SFTPD mRNA CTD PMID:32942007 Sftpd Rat hydrogen chloride decreases expression EXP 6480464 Hydrochloric Acid results in decreased expression of SFTPD protein CTD PMID:18573544 Sftpd Rat hydrogen chloride multiple interactions EXP 6480464 S-methylisothiopseudouronium inhibits the reaction [Hydrochloric Acid results in decreased expression of SFTPD protein] CTD PMID:18573544 Sftpd Rat hydrogen chloride increases expression EXP 6480464 Hydrochloric Acid results in increased expression of SFTPD protein CTD PMID:11880309 Sftpd Rat inulin multiple interactions ISO RGD:11287 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SFTPD mRNA CTD PMID:36331819 Sftpd Rat L-methionine multiple interactions ISO RGD:11287 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Sftpd Rat lipopolysaccharide multiple interactions ISO RGD:11287 6480464 [Ozone co-treated with Lipopolysaccharides] results in increased secretion of SFTPD protein; ERBB4 protein affects the more ... CTD PMID:21724861|PMID:38749002 Sftpd Rat lipopolysaccharide increases expression ISO RGD:11287 6480464 Lipopolysaccharides results in increased expression of SFTPD mRNA CTD PMID:21724861 Sftpd Rat lipopolysaccharide decreases expression ISO RGD:11287 6480464 Lipopolysaccharides results in decreased expression of SFTPD protein CTD PMID:21724861 Sftpd Rat mechlorethamine increases expression ISO RGD:11287 6480464 Mechlorethamine results in increased expression of SFTPD protein CTD PMID:30060251 Sftpd Rat mechlorethamine increases response to substance ISO RGD:11287 6480464 SFTPD gene mutant form results in increased susceptibility to Mechlorethamine CTD PMID:30060251 Sftpd Rat mechlorethamine multiple interactions ISO RGD:11287 6480464 SFTPD gene mutant form promotes the reaction [Mechlorethamine results in increased expression of CHIL3 protein]; more ... CTD PMID:30060251 Sftpd Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SFTPD mRNA CTD PMID:30047161 Sftpd Rat methylmercury chloride increases expression ISO RGD:735702 6480464 methylmercuric chloride results in increased expression of SFTPD mRNA CTD PMID:29581082 Sftpd Rat nitrates increases abundance ISO RGD:11287 6480464 SFTPD gene mutant form results in increased abundance of Nitrates CTD PMID:24465666 Sftpd Rat nitrates multiple interactions ISO RGD:11287 6480464 NOS2 gene mutant form inhibits the reaction [SFTPD gene mutant form results in increased abundance more ... CTD PMID:24465666 Sftpd Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of SFTPD mRNA CTD PMID:11057544 Sftpd Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of SFTPD mRNA CTD PMID:33484710 Sftpd Rat nitrogen dioxide multiple interactions ISO RGD:735702 6480464 [[Vehicle Emissions results in increased abundance of Air Pollutants] which results in increased abundance of more ... CTD PMID:37141245 Sftpd Rat O-methyleugenol decreases expression ISO RGD:735702 6480464 methyleugenol results in decreased expression of SFTPD mRNA CTD PMID:32234424 Sftpd Rat okadaic acid decreases expression ISO RGD:735702 6480464 Okadaic Acid results in decreased expression of SFTPD mRNA CTD PMID:38832940 Sftpd Rat ozone increases expression ISO RGD:11287 6480464 Ozone results in increased expression of SFTPD protein CTD PMID:22300504|PMID:36376488 Sftpd Rat ozone multiple interactions ISO RGD:11287 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549|PMID:36376488|PMID:38749002|PMID:39798125 Sftpd Rat paracetamol decreases expression ISO RGD:735702 6480464 Acetaminophen results in decreased expression of SFTPD mRNA CTD PMID:29067470 Sftpd Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SFTPD mRNA CTD PMID:30723492 Sftpd Rat paraquat decreases expression ISO RGD:735702 6480464 Paraquat results in decreased expression of SFTPD protein CTD PMID:17503247 Sftpd Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SFTPD protein CTD PMID:17616020 Sftpd Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SFTPD protein CTD PMID:17616020 Sftpd Rat paraquat multiple interactions EXP 6480464 [Paraquat co-treated with Oxygen] results in increased expression of SFTPD protein CTD PMID:11880309 Sftpd Rat paraquat decreases expression ISO RGD:11287 6480464 Paraquat results in decreased expression of SFTPD mRNA CTD PMID:17215068 Sftpd Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:11287 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SFTPD mRNA CTD PMID:36331819 Sftpd Rat phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [Terbutaline co-treated with Tetradecanoylphorbol Acetate] results in increased expression of SFTPD protein CTD PMID:9476903 Sftpd Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:11287 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in decreased expression of SFTPD mRNA CTD PMID:23519560 Sftpd Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SFTPD mRNA CTD PMID:19162173 Sftpd Rat progesterone decreases expression ISO RGD:11287 6480464 Progesterone results in decreased expression of SFTPD mRNA CTD PMID:22238285 Sftpd Rat resveratrol multiple interactions ISO RGD:735702 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of SFTPD mRNA CTD PMID:23557933 Sftpd Rat silicon dioxide decreases expression ISO RGD:735702 6480464 Silicon Dioxide analog results in decreased expression of SFTPD mRNA CTD PMID:25895662 Sftpd Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of SFTPD mRNA CTD PMID:18685790|PMID:22431001 Sftpd Rat sodium arsenite increases expression ISO RGD:735702 6480464 sodium arsenite results in increased expression of SFTPD mRNA CTD PMID:28229933 Sftpd Rat sodium arsenite decreases expression ISO RGD:11287 6480464 sodium arsenite results in decreased expression of SFTPD mRNA CTD PMID:37682722 Sftpd Rat Sucralfate decreases expression EXP 6480464 Sucralfate results in decreased expression of SFTPD protein CTD PMID:18573544 Sftpd Rat Sucralfate multiple interactions EXP 6480464 S-methylisothiopseudouronium inhibits the reaction [Sucralfate results in decreased expression of SFTPD protein] CTD PMID:18573544 Sftpd Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SFTPD mRNA CTD PMID:30047161 Sftpd Rat terbutaline multiple interactions EXP 6480464 [Terbutaline co-treated with Tetradecanoylphorbol Acetate] results in increased expression of SFTPD protein CTD PMID:9476903 Sftpd Rat titanium dioxide decreases expression ISO RGD:11287 6480464 titanium dioxide results in decreased expression of SFTPD mRNA CTD PMID:23131501|PMID:35295148 Sftpd Rat titanium dioxide increases expression ISO RGD:11287 6480464 titanium dioxide results in increased expression of SFTPD mRNA CTD PMID:23557971 Sftpd Rat toluene 2,4-diisocyanate increases expression ISO RGD:11287 6480464 Toluene 2,4-Diisocyanate results in increased expression of SFTPD mRNA CTD PMID:11379042 Sftpd Rat triclosan increases expression ISO RGD:735702 6480464 Triclosan results in increased expression of SFTPD mRNA CTD PMID:30510588 Sftpd Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SFTPD mRNA CTD PMID:19015723 Sftpd Rat vitamin D decreases expression ISO RGD:11287 6480464 Vitamin D deficiency results in decreased expression of SFTPD mRNA CTD PMID:32330513 Sftpd Rat zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of SFTPD mRNA CTD PMID:17557909
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beryllium sulfate (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bleomycin A2 (EXP,ISO) cadmium dichloride (EXP) carbon monoxide (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) D-glucose (ISO) decabromodiphenyl ether (ISO) dichlorine (ISO) Didecyldimethylammonium (ISO) dioxygen (EXP) epoxiconazole (ISO) folic acid (ISO) fumonisin B1 (ISO) furan (EXP) genistein (ISO) glucose (ISO) hydrogen chloride (EXP) inulin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) mechlorethamine (ISO) methimazole (EXP) methylmercury chloride (ISO) nitrates (ISO) nitrofen (EXP) nitrogen dioxide (ISO) O-methyleugenol (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phorbol 13-acetate 12-myristate (EXP,ISO) pirinixic acid (EXP) progesterone (ISO) resveratrol (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) Sucralfate (EXP) sulfadimethoxine (EXP) terbutaline (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) triclosan (ISO) vinclozolin (EXP) vitamin D (ISO) zearalenone (EXP)
1.
Pneumocystis carinii pneumonia alters expression and distribution of lung collectins SP-A and SP-D.
Atochina EN, etal., J Lab Clin Med. 2001 Jun;137(6):429-39.
2.
Attenuated allergic airway hyperresponsiveness in C57BL/6 mice is associated with enhanced surfactant protein (SP)-D production following allergic sensitization.
Atochina EN, etal., Respir Res. 2003 Dec 8;4:15. Print 2003.
3.
Immune reconstitution during Pneumocystis lung infection: disruption of surfactant component expression and function by S-nitrosylation.
Atochina-Vasserman EN, etal., J Immunol. 2009 Feb 15;182(4):2277-87.
4.
Recombinant rat surfactant-associated protein D inhibits human T lymphocyte proliferation and IL-2 production.
Borron PJ, etal., J Immunol. 1998 Nov 1;161(9):4599-603.
5.
Patterns of neutrophil serine protease-dependent cleavage of surfactant protein D in inflammatory lung disease.
Cooley J, etal., J Leukoc Biol. 2008 Apr;83(4):946-55. Epub 2008 Jan 22.
6.
Association between single nucleotide polymorphisms of surfactant protein D and allergic rhinitis in Chinese patients.
Deng YQ, etal., Tissue Antigens. 2009 Jun;73(6):546-52.
7.
Regulation of surfactant protein D expression by glucocorticoids in vitro and in vivo.
Deterding RR, etal., Am J Respir Cell Mol Biol. 1994 Jan;10(1):30-7.
8.
Sivelestat sodium hydrate improves septic acute lung injury by reducing alveolar dysfunction.
Endo S, etal., Res Commun Mol Pathol Pharmacol. 2006;119(1-6):53-65.
9.
Surfactant protein levels in bronchoalveolar lavage after segmental allergen challenge in patients with asthma.
Erpenbeck VJ, etal., Allergy. 2006 May;61(5):598-604.
10.
Surfactant protein D increases phagocytosis and aggregation of pollen-allergen starch granules.
Erpenbeck VJ, etal., Am J Physiol Lung Cell Mol Physiol. 2005 Apr;288(4):L692-8. Epub 2004 Dec 10.
11.
Surfactant protein D inhibits early airway response in Aspergillus fumigatus-sensitized mice.
Erpenbeck VJ, etal., Clin Exp Allergy. 2006 Jul;36(7):930-40.
12.
Pulmonary-specific expression of SP-D corrects pulmonary lipid accumulation in SP-D gene-targeted mice.
Fisher JH, etal., Am J Physiol Lung Cell Mol Physiol. 2000 Feb;278(2):L365-73.
13.
Polymorphisms in Surfactant Protein D are Associated with COPD.
Foreman MG, etal., Am J Respir Cell Mol Biol. 2010 May 6.
14.
Serum surfactant protein D is increased in acute and chronic inflammation in mice.
Fujita M, etal., Cytokine. 2005 Jul 7;31(1):25-33.
15.
Rat respiratory coronavirus infection: replication in airway and alveolar epithelial cells and the innate immune response.
Funk CJ, etal., J Gen Virol. 2009 Dec;90(Pt 12):2956-64. Epub 2009 Sep 9.
16.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
17.
Relationship between pulmonary surfactant protein and lipid peroxidation in lung injury due to paraquat intoxication in rats.
Gil HW, etal., Korean J Intern Med. 2007 Jun;22(2):67-72.
18.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
19.
Serial changes in surfactant-associated proteins in lung and serum before and after onset of ARDS.
Greene KE, etal., Am J Respir Crit Care Med. 1999 Dec;160(6):1843-50.
20.
Pulmonary surfactant, lung function, and endobronchial inflammation in cystic fibrosis.
Griese M, etal., Am J Respir Crit Care Med. 2004 Nov 1;170(9):1000-5. Epub 2004 Jul 21.
21.
Children with absent surfactant protein D in bronchoalveolar lavage have more frequently pneumonia.
Griese M, etal., Pediatr Allergy Immunol. 2008 Nov;19(7):639-47. Epub 2008 Feb 11.
22.
S-nitrosylation of surfactant protein-D controls inflammatory function.
Guo CJ, etal., PLoS Biol. 2008 Nov 11;6(11):e266. doi: 10.1371/journal.pbio.0060266.
23.
Aspergillus fumigatus-induced allergic airway inflammation alters surfactant homeostasis and lung function in BALB/c mice.
Haczku A, etal., Am J Respir Cell Mol Biol. 2001 Jul;25(1):45-50.
24.
Surfactant protein D and KL-6 as serum biomarkers of interstitial lung disease in patients with scleroderma.
Hant FN, etal., J Rheumatol. 2009 Apr;36(4):773-80. Epub 2009 Mar 13.
25.
Circulating surfactant protein D is decreased in systemic lupus erythematosus.
Hoegh SV, etal., J Rheumatol. 2009 Nov;36(11):2449-53. Epub 2009 Oct 15.
26.
Nihon Kyobu Shikkan Gakkai zasshi
Honda Y Nihon Kyobu Shikkan Gakkai Zasshi. 1996 Dec;34 Suppl:181-5.
27.
Surfactant protein-D and surfactant inhibit endotoxin-induced pulmonary inflammation.
Ikegami M, etal., Chest. 2007 Nov;132(5):1447-54. Epub 2007 Oct 9.
28.
SP-D-deficient mice are resistant to hyperoxia.
Jain D, etal., Am J Physiol Lung Cell Mol Physiol. 2007 Apr;292(4):L861-71. Epub 2006 Dec 8.
29.
Surfactant protein D protects against acute hyperoxic lung injury.
Jain D, etal., Am J Respir Crit Care Med. 2008 Oct 15;178(8):805-13. Epub 2008 Jul 17.
30.
The role of surfactant protein D in the colonisation of the respiratory tract and onset of bacteraemia during pneumococcal pneumonia.
Jounblat R, etal., Respir Res. 2005 Oct 28;6:126.
31.
Eosinophilic inclusions in rat Clara cells and the effect of an inhaled corticosteroid.
Kambara T, etal., Toxicol Pathol. 2009;37(3):315-23.
32.
Surfactant protein levels in severe respiratory syncytial virus infection.
Kerr MH and Paton JY, Am J Respir Crit Care Med. 1999 Apr;159(4 Pt 1):1115-8.
33.
Surfactant Protein D Deficiency Increases Lung Injury during Endotoxemia.
King BA and Kingma PS, Am J Respir Cell Mol Biol. 2010 Jul 16.
34.
Correction of pulmonary abnormalities in Sftpd-/- mice requires the collagenous domain of surfactant protein D.
Kingma PS, etal., J Biol Chem. 2006 Aug 25;281(34):24496-505. Epub 2006 Jun 20.
35.
Elevation of surfactant protein D, a pulmonary disease biomarker, in the sera of uveitis patients with sarcoidosis.
Kitaichi N, etal., Jpn J Ophthalmol. 2010 Jan;54(1):81-4. Epub 2010 Feb 12.
36.
Pulmonary collectins enhance phagocytosis of Mycobacterium avium through increased activity of mannose receptor.
Kudo K, etal., J Immunol. 2004 Jun 15;172(12):7592-602.
37.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
38.
Characterization of the rat pulmonary surfactant protein A promoter.
Lacaze-Masmonteil T, etal., Eur J Biochem 1992 Jun 15;206(3):613-23.
39.
Clinical importance of bronchoalveolar lavage fluid and blood cytokines, surfactant protein D, and Kerbs von Lungren 6 antigen in idiopathic pulmonary alveolar proteinosis.
Lin FC, etal., Mayo Clin Proc. 2008 Dec;83(12):1344-9.
40.
Heterogeneous allele expression of pulmonary SP-D gene in rat large intestine and other tissues.
Lin Z and Floros J, Physiol Genomics 2002 Dec 3;11(3):235-43.
41.
Susceptibility of mice genetically deficient in SP-A or SP-D gene to invasive pulmonary aspergillosis.
Madan T, etal., Mol Immunol. 2010 Jun;47(10):1923-30. Epub 2010 Apr 21.
42.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
43.
Prognostic value of serum surfactant protein D level prior to transplant for the development of bronchiolitis obliterans syndrome and idiopathic pneumonia syndrome following allogeneic hematopoietic stem cell transplantation.
Nakane T, etal., Bone Marrow Transplant. 2008 Jul;42(1):43-9. Epub 2008 Mar 17.
44.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
45.
Genetic variants of surfactant proteins A, B, C, and D in bronchopulmonary dysplasia.
Pavlovic J, etal., Dis Markers. 2006;22(5-6):277-91.
46.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
47.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
48.
GOA pipeline
RGD automated data pipeline
49.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
50.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
51.
Total extracellular surfactant is increased but abnormal in a rat model of gram-negative bacterial pneumonia.
Russo TA, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Sep;283(3):L655-63.
52.
Respiratory distress after intratracheal bleomycin: selective deficiency of surfactant proteins B and C.
Savani RC, etal., Am J Physiol Lung Cell Mol Physiol. 2001 Sep;281(3):L685-96.
53.
Pulmonary surfactant in patients with Pneumocystis pneumonia and acquired immunodeficiency syndrome.
Schmidt R, etal., Crit Care Med. 2006 Sep;34(9):2370-6.
54.
Distribution of surfactant proteins in type II pneumocytes of newborn, 14-day old, and adult rats: an immunoelectron microscopic and stereological study.
Schmiedl A, etal., Histochem Cell Biol. 2005 Dec;124(6):465-76. Epub 2005 Sep 27.
55.
Increased surfactant protein a and d expression in acute ovalbumin-induced allergic airway inflammation in brown norway rats.
Schmiedl A, etal., Int Arch Allergy Immunol. 2009;148(2):118-26. Epub 2008 Sep 19.
56.
Serum surfactant protein D during acute exacerbations of chronic obstructive pulmonary disease.
Shakoori TA, etal., Dis Markers. 2009;27(6):287-94.
57.
Primary structure of rat pulmonary surfactant protein D. cDNA and deduced amino acid sequence.
Shimizu H, etal., J Biol Chem 1992 Jan 25;267(3):1853-7.
58.
The effects of fluticasone with or without salmeterol on systemic biomarkers of inflammation in chronic obstructive pulmonary disease.
Sin DD, etal., Am J Respir Crit Care Med. 2008 Jun 1;177(11):1207-14. Epub 2008 Feb 28.
59.
Surfactant protein D and bronchial dysplasia in smokers at high risk of lung cancer.
Sin DD, etal., Chest. 2008 Sep;134(3):582-8.
60.
The association between BMI and plasma cytokine levels in patients with acute lung injury.
Stapleton RD, etal., Chest. 2010 Sep;138(3):568-77. Epub 2010 Apr 30.
61.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
62.
Surfactant protein D regulates airway function and allergic inflammation through modulation of macrophage function.
Takeda K, etal., Am J Respir Crit Care Med. 2003 Oct 1;168(7):783-9. Epub 2003 Jul 25.
63.
Adsorption of pulmonary surfactant protein D to phospholipid monolayers at the air-water interface.
Taneva S, etal., Biochemistry. 1997 Jul 1;36(26):8173-9.
64.
Haplotypes of the surfactant protein genes A and D as susceptibility factors for the development of respiratory distress syndrome.
Thomas NJ, etal., Acta Paediatr. 2007 Jul;96(7):985-9. Epub 2007 May 24.
65.
Transmission of surfactant protein variants and haplotypes in children hospitalized with respiratory syncytial virus.
Thomas NJ, etal., Pediatr Res. 2009 Jul;66(1):70-3.
66.
Novel strategy to identify genetic risk factors for COPD severity: a genetic isolate.
van Diemen CC, etal., Eur Respir J. 2010 Apr;35(4):768-75. Epub 2009 Sep 24.
67.
Recognition of heptoses and the inner core of bacterial lipopolysaccharides by surfactant protein d.
Wang H, etal., Biochemistry. 2008 Jan 15;47(2):710-20. Epub 2007 Dec 20.
68.
Elevated expression of surfactant proteins in newborn rats during adaptation to hyperoxia.
White CW, etal., Am J Respir Cell Mol Biol. 2001 Jul;25(1):51-9.
69.
Multimerization of surfactant protein D, but not its collagen domain, is required for antiviral and opsonic activities related to influenza virus.
White M, etal., J Immunol. 2008 Dec 1;181(11):7936-43.
70.
Sinonasal surfactant protein A1, A2, and D gene expression in cystic fibrosis: a preliminary report.
Woodworth BA, etal., Otolaryngol Head Neck Surg. 2007 Jul;137(1):34-8.
71.
Serum levels of surfactant protein D predict the anti-tumor activity of gefitinib in patients with advanced non-small cell lung cancer.
Yamaguchi H, etal., Cancer Chemother Pharmacol. 2010 Apr 17.
72.
Prescreening based on the presence of CT-scan abnormalities and biomarkers (KL-6 and SP-D) may reduce severe radiation pneumonitis after stereotactic radiotherapy.
Yamashita H, etal., Radiat Oncol. 2010 May 9;5:32.
73.
KGF regulates pulmonary epithelial proliferation and surfactant protein gene expression in adult rat lung.
Yano T, etal., Am J Physiol Lung Cell Mol Physiol. 2000 Dec;279(6):L1146-58.
74.
Surfactant protein D-mediated aggregation of Pneumocystis carinii impairs phagocytosis by alveolar macrophages.
Yong SJ, etal., Infect Immun. 2003 Apr;71(4):1662-71.
75.
Reversibility of pulmonary abnormalities by conditional replacement of surfactant protein D (SP-D) in vivo.
Zhang L, etal., J Biol Chem 2002 Oct 11;277(41):38709-13.
Sftpd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 17,080,575 - 17,093,047 (-) NCBI GRCr8 mRatBN7.2 16 17,046,491 - 17,058,968 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 17,046,483 - 17,059,927 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 17,110,520 - 17,122,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 18,238,920 - 18,251,351 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 17,163,418 - 17,175,790 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 18,753,535 - 18,766,100 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 18,745,458 - 18,766,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 18,621,441 - 18,633,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 16 17,272,045 - 17,284,082 (-) NCBI Celera RH 3.4 Map 16 167.0 RGD Cytogenetic Map 16 p14 NCBI
SFTPD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 79,937,740 - 79,982,383 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 79,937,467 - 79,982,614 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 81,697,496 - 81,708,861 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 81,687,476 - 81,698,841 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 81,687,486 - 81,698,836 NCBI Celera 10 75,688,432 - 75,699,799 (-) NCBI Celera Cytogenetic Map 10 q22.3 NCBI HuRef 10 75,540,246 - 75,551,613 (-) NCBI HuRef CHM1_1 10 81,980,534 - 81,991,901 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 80,806,973 - 80,851,624 (-) NCBI T2T-CHM13v2.0
Sftpd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 40,894,169 - 40,907,155 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 40,894,171 - 40,907,106 (-) Ensembl GRCm39 Ensembl GRCm38 14 41,172,212 - 41,185,198 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 41,172,214 - 41,185,149 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 41,985,501 - 41,998,487 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 40,080,927 - 40,093,876 (-) NCBI MGSCv36 mm8 Celera 14 37,332,219 - 37,345,205 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 22.36 NCBI
Sftpd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955510 213,438 - 225,896 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955510 213,468 - 226,096 (+) NCBI ChiLan1.0 ChiLan1.0
SFTPD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 91,904,806 - 91,950,749 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 91,910,131 - 91,957,119 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 76,275,147 - 76,318,952 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 78,965,252 - 78,974,181 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 78,965,252 - 78,974,181 (+) Ensembl panpan1.1 panPan2
SFTPD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 29,394,755 - 29,407,499 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 29,394,678 - 29,407,293 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 29,519,118 - 29,533,724 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 29,696,757 - 29,711,366 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 29,696,745 - 29,709,347 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 29,566,382 - 29,580,989 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 29,769,003 - 29,783,612 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 30,123,008 - 30,137,617 (+) NCBI UU_Cfam_GSD_1.0
Sftpd
SFTPD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 82,051,451 - 82,067,976 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 82,051,400 - 82,069,258 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 88,660,094 - 88,675,023 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SFTPD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 51,809,241 - 51,820,974 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 51,811,052 - 51,820,650 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 12,161,420 - 12,172,864 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sftpd
.
Predicted Target Of
Count of predictions: 232 Count of miRNA genes: 91 Interacting mature miRNAs: 103 Transcripts: ENSRNOT00000070955, ENSRNOT00000074559 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 61372 Bp40 Blood pressure QTL 40 2.2 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 16 4227730 17696785 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
D16Wox24
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 17,058,975 - 17,059,157 (+) MAPPER mRatBN7.2 Rnor_6.0 16 18,766,108 - 18,766,289 NCBI Rnor6.0 Rnor_5.0 16 18,633,589 - 18,633,770 UniSTS Rnor5.0 Celera 16 17,284,090 - 17,284,265 UniSTS Cytogenetic Map 16 p14 UniSTS
AI573415
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 17,046,668 - 17,046,804 (+) MAPPER mRatBN7.2 Rnor_6.0 16 18,753,713 - 18,753,848 NCBI Rnor6.0 Rnor_5.0 16 18,621,619 - 18,621,754 UniSTS Rnor5.0 Celera 16 17,272,223 - 17,272,358 UniSTS Cytogenetic Map 16 p14 UniSTS
RH94509
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 17,046,492 - 17,046,598 (+) MAPPER mRatBN7.2 Rnor_6.0 16 18,753,537 - 18,753,642 NCBI Rnor6.0 Rnor_5.0 16 18,621,443 - 18,621,548 UniSTS Rnor5.0 Celera 16 17,272,047 - 17,272,152 UniSTS RH 3.4 Map 16 167.0 UniSTS Cytogenetic Map 16 p14 UniSTS
Sftpd
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 17,051,323 - 17,051,671 (+) MAPPER mRatBN7.2 Rnor_6.0 16 18,758,327 - 18,758,674 NCBI Rnor6.0 Rnor_5.0 16 18,625,808 - 18,626,155 UniSTS Rnor5.0 Celera 16 17,276,468 - 17,276,815 UniSTS Cytogenetic Map 16 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
20
42
85
84
53
25
53
6
152
67
22
15
41
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000084172 ⟹ ENSRNOP00000074951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 17,046,483 - 17,058,978 (-) Ensembl Rnor_6.0 Ensembl 16 18,753,643 - 18,757,918 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084813 ⟹ ENSRNOP00000069079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 17,046,483 - 17,059,927 (-) Ensembl Rnor_6.0 Ensembl 16 18,745,458 - 18,766,174 (-) Ensembl
RefSeq Acc Id:
NM_012878 ⟹ NP_037010
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 17,080,575 - 17,093,047 (-) NCBI mRatBN7.2 16 17,046,491 - 17,058,968 (-) NCBI Rnor_6.0 16 18,753,535 - 18,766,100 (-) NCBI Rnor_5.0 16 18,621,441 - 18,633,581 (-) NCBI Celera 16 17,272,045 - 17,284,082 (-) RGD
Sequence:
ACCAGGAAGCAATCTGCCATGCTTCACTTTCTCTCCATGCTTGTCCTGCTTGTACAGCCCCTGGGCGATCTGGGAGCAGAAATGAAGACCCTTTCGCAGAGATCAATAACCAACACGTGCACCCTAGT
hide sequence
RefSeq Acc Id:
NP_037010 ⟸ NM_012878
- Peptide Label:
precursor
- UniProtKB:
P35248 (UniProtKB/Swiss-Prot), A6K9M0 (UniProtKB/TrEMBL), Q6IRS7 (UniProtKB/TrEMBL)
- Sequence:
MLHFLSMLVLLVQPLGDLGAEMKTLSQRSITNTCTLVLCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLPGPRGPVGPKGENGSAGEPGPKGERGLVGPPGSPGISGPAGKEGPSGKQGNI
hide sequence
Ensembl Acc Id:
ENSRNOP00000069079 ⟸ ENSRNOT00000084813
Ensembl Acc Id:
ENSRNOP00000074951 ⟸ ENSRNOT00000084172
RGD ID: 13699977 Promoter ID: EPDNEW_R10499 Type: single initiation site Name: Sftpd_1 Description: surfactant protein D SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 18,766,126 - 18,766,186 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-30
Sftpd
surfactant protein D
Sftpd
surfactant associated protein D
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-07-23
Sftpd
surfactant, pulmonary-associated protein D
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
2001-07-23
Sftpd
Pulmonary surfactant protein D
Name withdrawn
67952 WITHDRAWN
Note Type
Note
Reference
gene_expression
synthesized by alveolar type II epithelial cells
729918
