Rln1 (relaxin 1) - Rat Genome Database

Name: Rln1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Rln1 (relaxin 1) Rattus norvegicus

Analyze

Symbol:

Rln1

Name:

relaxin 1

RGD ID:

3579

Description:

Predicted to enable signaling receptor binding activity. Involved in negative regulation of apoptotic process and regulation of cell population proliferation. Acts upstream of or within adenylate cyclase-modulating G protein-coupled receptor signaling pathway and regulation of nitric oxide mediated signal transduction. Predicted to be located in extracellular region. Orthologous to several human genes including RLN1 (relaxin 1); INTERACTS WITH ammonium chloride; berberine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

preprorelaxin; prorelaxin 1; RELAX; Relaxin 1 (H1)

RGD Orthologs

Human

Mouse

Bonobo

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RLN1 (relaxin 1)	HGNC	Ensembl, HomoloGene, Inparanoid, Panther, PhylomeDB
Mus musculus (house mouse):	Rln1 (relaxin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100982570 (prorelaxin H1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RLN2 (relaxin 2)	HGNC	Ensembl, OrthoDB, Panther
Homo sapiens (human):	INSL4 (insulin like 4)	HGNC	Panther
Homo sapiens (human):	RAB40B (RAB40B, member RAS oncogene family)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rln1 (relaxin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RLN1 (relaxin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	RLN2 (relaxin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rflb	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	236,493,532 - 236,496,541 (-)	NCBI		GRCr8
mRatBN7.2	1	227,079,960 - 227,082,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	227,079,966 - 227,082,882 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	235,481,608 - 235,484,509 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	242,411,272 - 242,414,173 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	235,228,554 - 235,231,480 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	247,483,298 - 247,486,331 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	247,483,302 - 247,486,202 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	254,731,580 - 254,734,531 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	233,000,540 - 233,003,444 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	233,164,562 - 233,167,467 (-)	NCBI
Celera	1	224,231,880 - 224,234,784 (-)	NCBI		Celera
RH 3.4 Map	1	1616.7	RGD
Cytogenetic Map	1	q52	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 9p deletion syndrome (ISO)

Hypertrophy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

alpha-Zearalanol (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

berberine (EXP)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

dibutyl phthalate (EXP)

entinostat (ISO)

fenvalerate (EXP)

flavonoids (EXP)

fulvestrant (ISO)

hydrogen peroxide (EXP,ISO)

levonorgestrel (ISO)

perfluorohexanesulfonic acid (ISO)

propazine (ISO)

silicon dioxide (ISO)

simazine (ISO)

sodium arsenite (ISO)

Soman (EXP)

terbutylazine (ISO)

testosterone (ISO)

testosterone undecanoate (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IGI)

developmental growth (ISO)

mammary gland morphogenesis (ISO)

negative regulation of apoptotic process (IMP)

nipple development (ISO)

prostate gland growth (ISO)

regulation of apoptotic process (ISO)

regulation of body fluid levels (TAS)

regulation of cell population proliferation (IMP)

regulation of nitric oxide mediated signal transduction (IDA,ISO)

signal transduction (IEA)

spermatogenesis (ISO)

Cellular Component

extracellular region (IEA)

Molecular Function

hormone activity (IEA,TAS)

protein binding (ISO)

signaling receptor binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and characterization of cDNA sequences coding for rat relaxin.	Hudson P, etal., Nature 1981 May 14;291(5811):127-31.
2.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
3.	The extent to which relaxin promotes proliferation and inhibits apoptosis of cervical epithelial and stromal cells is greatest during late pregnancy in rats.	Lee HY, etal., Endocrinology. 2005 Jan;146(1):511-8. Epub 2004 Oct 21.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Relaxin inhibits renal myofibroblast differentiation via RXFP1, the nitric oxide pathway, and Smad2.	Mookerjee I, etal., FASEB J. 2009 Apr;23(4):1219-29. doi: 10.1096/fj.08-120857. Epub 2008 Dec 10.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Rat preprorelaxin: complete amino acid sequence derived from cDNA analysis.	Niall H, etal., Ann N Y Acad Sci 1982;380:13-21.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Circulating relaxin acts on subfornical organ neurons to stimulate water drinking in the rat.	Sunn N, etal., Proc Natl Acad Sci U S A 2002 Feb 5;99(3):1701-1706.
11.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:7004862	PMID:8216305	PMID:9886856	PMID:12861045	PMID:15155573	PMID:15198972	PMID:16926527	PMID:16956745	PMID:19261221	PMID:19542742	PMID:21272344	PMID:21410550
PMID:22363579	PMID:22744867	PMID:23207895	PMID:24640565	PMID:24640566	PMID:28606038	PMID:28776188	PMID:31811156

Genomics

Comparative Map Data

Rln1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	236,493,532 - 236,496,541 (-)	NCBI		GRCr8
mRatBN7.2	1	227,079,960 - 227,082,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	227,079,966 - 227,082,882 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	235,481,608 - 235,484,509 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	242,411,272 - 242,414,173 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	235,228,554 - 235,231,480 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	247,483,298 - 247,486,331 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	247,483,302 - 247,486,202 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	254,731,580 - 254,734,531 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	233,000,540 - 233,003,444 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	233,164,562 - 233,167,467 (-)	NCBI
Celera	1	224,231,880 - 224,234,784 (-)	NCBI		Celera
RH 3.4 Map	1	1616.7	RGD
Cytogenetic Map	1	q52	NCBI

RLN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	5,334,930 - 5,340,916 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	5,334,930 - 5,339,876 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	5,334,930 - 5,339,876 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	5,324,969 - 5,329,873 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	5,324,968 - 5,329,873	NCBI
Celera	9	5,260,593 - 5,265,497 (-)	NCBI		Celera
Cytogenetic Map	9	p24.1	NCBI
HuRef	9	5,290,420 - 5,295,595 (-)	NCBI		HuRef
CHM1_1	9	5,335,103 - 5,340,044 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	5,340,023 - 5,345,993 (-)	NCBI		T2T-CHM13v2.0

Rln1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	29,309,155 - 29,312,070 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	29,308,570 - 29,312,070 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	29,331,755 - 29,334,670 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	29,331,170 - 29,334,670 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	29,406,245 - 29,409,160 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	29,397,695 - 29,400,593 (-)	NCBI		MGSCv36	mm8
Celera	19	30,108,320 - 30,111,235 (-)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	23.83	NCBI

LOC100982570
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	119,212,769 - 119,218,288 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	119,141,982 - 119,224,235 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	5,173,570 - 5,255,799 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	5,359,582 - 5,364,386 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	5,359,582 - 5,364,386 (-)	Ensembl	panpan1.1		panPan2

Variants

Variants in Rln1
26 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	30
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000021315
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	207702246	228581766	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
6480786	Bw97	Body weight QTL 97	5.03		body mass (VT:0001259)	body weight (CMO:0000012)	1	225126575	227604520	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat

Markers in Region

D1Bda60

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	227,080,097 - 227,080,297 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,483,432 - 247,483,631	NCBI	Rnor6.0
Rnor_5.0	1	254,731,718 - 254,731,917	UniSTS	Rnor5.0
RGSC_v3.4	1	233,000,674 - 233,000,873	UniSTS	RGSC3.4
Celera	1	224,232,014 - 224,232,213	UniSTS
Cytogenetic Map	1	q52	UniSTS

RH94497

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	227,080,020 - 227,080,152 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	247,483,355 - 247,483,486	NCBI	Rnor6.0
Rnor_5.0	1	254,731,641 - 254,731,772	UniSTS	Rnor5.0
RGSC_v3.4	1	233,000,597 - 233,000,728	UniSTS	RGSC3.4
Celera	1	224,231,937 - 224,232,068	UniSTS
RH 3.4 Map	1	1616.7	UniSTS
Cytogenetic Map	1	q52	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium											6
Low									169	18	38	3
Below cutoff	9	47	90	50	20	50	22	26	69	54	58		12

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006231196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY240029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J00780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V01264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088193 ⟹ ENSRNOP00000072430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	227,079,966 - 227,082,882 (-)	Ensembl
Rnor_6.0 Ensembl	1	247,483,302 - 247,486,202 (-)	Ensembl

RefSeq Acc Id:

NM_013413 ⟹ NP_038199

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	236,493,536 - 236,496,440 (-)	NCBI
mRatBN7.2	1	227,079,964 - 227,082,870 (-)	NCBI
Rnor_6.0	1	247,483,298 - 247,486,202 (-)	NCBI
Rnor_5.0	1	254,731,580 - 254,734,531 (-)	NCBI
RGSC_v3.4	1	233,000,540 - 233,003,444 (-)	RGD
Celera	1	224,231,880 - 224,234,784 (-)	RGD

Sequence:

show sequence

CTGAACCGCCCAGGAGCACCGCCCAGGAGCAGCCCAGACCGGAATGTCCAGCAGACTCTTGCTC
CAGCTCCTGGGGTTCTGGCTGTTCCTGAGCCAGCCTTGCAGGGCGCGAGTCTCGGAGGAGTGGA
TGGACCAAGTCATTCAGGTGTGCGGCCGTGGATATGCCCGCGCATGGATCGAAGTCTGCGGGGC
CTCCGTGGGAAGACTGGCTTTGAGCCAGGAGGAGCCAGCTCCGCTAGCCAGGCAAGCCACTGCA
GAAGTTGTGCCATCCTTCATCAACAAAGATGCGGAGCCTTTCGATATGACGTTGAAATGCCTTC
CAAATTTGTCTGAGGAGCGGAAGGCAGCACTGTCTGAGGGGCGAGCACCGTTCCCAGAGCTACA
ACAACACGCACCCGCGTTGAGCGATTCCGTTGTTAGCTTGGAAGGATTTAAGAAAACTTTCCAC
AATCAGCTGGGTGAAGCAGAAGATGGCGGTCCTCCAGAGCTCAAATACTTAGGCTCAGATGCTC
AGTCACGGAAAAAGAGGCAGTCTGGCGCACTGCTCAGTGAGCAGTGTTGCCACATCGGTTGTAC
CAGAAGATCCATTGCTAAACTCTGCTGATACGGAGCTAATGGTGCGCAACCCGGGCAGTGTCGC
GTGCGTTCTTGCTACCTGGCTAATGCCTCTTTCTGTCCCCTTTTCTTATTTATTAGGATCTGAG
AAACCATAATTCACACTTGGATTTGTCCTTTGATAAGAGAGAAATGTTCTCTGCATTGTTGTAG
TTCTGTTAATAATATTTTTATGCAAAAACTTT

hide sequence

RefSeq Acc Id:

XM_006231196 ⟹ XP_006231258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	236,493,532 - 236,496,541 (-)	NCBI
mRatBN7.2	1	227,079,960 - 227,082,960 (-)	NCBI
Rnor_6.0	1	247,483,320 - 247,486,331 (-)	NCBI
Rnor_5.0	1	254,731,580 - 254,734,531 (-)	NCBI

Sequence:

show sequence

ACAATACCATGCACGCGTGGGTGGGAAGTGGGTGGAGCTGGAACCATCAACACCGGTGCTCAGA
GCTCCCGAGGGATATAAAAGCCGATTGAGCTCTAGGAAAGCAGCAGGAGCCCAGTCCCGCCAAG
GCTGAACCGCCCAGGAGCACCGCCCAGGAGCAGCCCAGACCGGAATGTCCAGCAGACTCTTGCT
CCAGCTCCTGGGGTTCTGGCTGTTCCTGAGCCAGCCTTGCAGGGCGCGAGTCTCGGAGGAGTGG
ATGGACCAAGTCATTCAGGTGTGCGGCCGTGGATATGCCCGCGCATGGATCGAAGTCTGCGGGG
CCTCCGTGGGAAGACTGGCTTTGAGCCAGGAGGAGCCAGCTCCGCTAGCCAGGCAAGCCACTGA
AGTTGTGCCATCCTTCATCAACAAAGATGCGGAGCCTTTCGATATGACGTTGAAATGCCTTCCA
AATTTGTCTGAGGAGCGGAAGGCAGCACTGTCTGAGGGGCGAGCACCGTTCCCAGAGCTACAAC
AACACGCACCCGCGTTGAGCGATTCCGTTGTTAGCTTGGAAGGATTTAAGAAAACTTTCCACAA
TCAGCTGGGTGAAGCAGAAGATGGCGGTCCTCCAGAGCTCAAATACTTAGGCTCAGATGCTCAG
TCACGGAAAAAGAGGCAGTCTGGCGCACTGCTCAGTGAGCAGTGTTGCCACATCGGTTGTACCA
GAAGATCCATTGCTAAACTCTGCTGATACGGAGCTAATGGTGCGCAACCCGGGCAGTGTCCGGG
TGCGTTCTTGCTACCTGGCTAATGCCTCTTTCTGTCCCCTTTTCTTATTTATTAGGATCTGAGA
AACCATAATTCACACTTGGATTTGTCCTTTGATAAGAGAGAAATGTTCTCTGCATTGTTGTAGT
TCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_038199	(Get FASTA)	NCBI Sequence Viewer
	XP_006231258	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42029	(Get FASTA)	NCBI Sequence Viewer
	AAP41739	(Get FASTA)	NCBI Sequence Viewer
	AAP41740	(Get FASTA)	NCBI Sequence Viewer
	CAA24578	(Get FASTA)	NCBI Sequence Viewer
	EDM13089	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072430.2
GenBank Protein	P01347	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_038199 ⟸ NM_013413
- Peptide Label:	precursor
- UniProtKB:	Q78N50 (UniProtKB/Swiss-Prot), P01347 (UniProtKB/Swiss-Prot), A6I0V8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSRLLLQLLGFWLFLSQPCRARVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLALSQEEPAP LARQATAEVVPSFINKDAEPFDMTLKCLPNLSEERKAALSEGRAPFPELQQHAPALSDSVVSLE GFKKTFHNQLGEAEDGGPPELKYLGSDAQSRKKRQSGALLSEQCCHIGCTRRSIAKLC hide sequence

RefSeq Acc Id:	XP_006231258 ⟸ XM_006231196
- Peptide Label:	isoform X1
- UniProtKB:	Q7TQA2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSRLLLQLLGFWLFLSQPCRARVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLALSQEEPAP LARQATEVVPSFINKDAEPFDMTLKCLPNLSEERKAALSEGRAPFPELQQHAPALSDSVVSLEG FKKTFHNQLGEAEDGGPPELKYLGSDAQSRKKRQSGALLSEQCCHIGCTRRSIAKLC hide sequence

Ensembl Acc Id:

ENSRNOP00000072430 ⟸ ENSRNOT00000088193

Protein Domains

Insulin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P01347-F1-model_v2	AlphaFold	P01347	1-186	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3579	AgrOrtholog
BioCyc Gene	G2FUF-55970	BioCyc
Ensembl Genes	ENSRNOG00000060867	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088193.2	UniProtKB/TrEMBL
InterPro	Insulin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Insulin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Insulin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Relaxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Repro_Hormone_Insulin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25616	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25616	ENTREZGENE
PANTHER	PRORELAXIN H2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RELAXIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Insulin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rln1	PhenoGen
PRINTS	RELAXIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	INSULIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060867	RatGTEx
SMART	IlGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56994	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC220512
UniProt	A6I0V8	ENTREZGENE, UniProtKB/TrEMBL
	P01347	ENTREZGENE
	Q78N50	ENTREZGENE
	Q7TQA2	ENTREZGENE, UniProtKB/TrEMBL
	REL1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q78N50	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rln1	relaxin 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_process	functions in pregnancy and body fluid balance	70239
gene_process	stimulates subfornical organ neurons initiating water drinking; may stimulate organum vasculosum of the lamina terminalis neurons to secrete vasopressin	70239

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD