Advanced Search (OLGA)

Gene: MYMK (myomaker, myoblast fusion factor) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

MYMK

Name:

myomaker, myoblast fusion factor

RGD ID:

3302829

HGNC Page

HGNC:33778

Description:

Involved in myoblast fusion. Located in plasma membrane. Implicated in Carey-Fineman-Ziter syndrome.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

M83-like; myoblast fusion maker; myomaker; TMEM226; TMEM8C; transmembrane protein 226; transmembrane protein 8-like; transmembrane protein 8C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	133,514,586 - 133,524,959 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	133,514,586 - 133,528,612 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	136,379,708 - 136,390,081 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	135,369,579 - 135,379,787 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Cytogenetic Map	9	q34.2	NCBI
HuRef	9	105,880,949 - 105,891,314 (-)	NCBI		HuRef
CHM1_1	9	136,529,867 - 136,540,211 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	145,728,593 - 145,738,968 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital nonprogressive myopathy with Moebius and Robin sequences	ClinVar	PMID:28681861 and PMID:29560417
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: MYOPATHY more ...	ClinVar	PMID:25741868 more ...
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Congenital nonprogressive myopathy with Moebius and Robin sequences	ClinVar	PMID:28681861
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens) more ...	8554872	ClinVar more ...	ClinVar	PMID:25741868
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital nonprogressive myopathy with Moebius and Robin sequences	ClinVar	PMID:25741868 and PMID:28681861
MYMK	Human	Carey-Fineman-Ziter syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital nonprogressive myopathy with Moebius and Robin sequences	ClinVar	PMID:25741868 and PMID:30016436
MYMK	Human	Carey-Fineman-Ziter Syndrome 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Carey-Fineman-Ziter syndrome 1	ClinVar	PMID:25741868 more ...
MYMK	Human	Carey-Fineman-Ziter Syndrome 1		IAGP	(Homo sapiens) and (Homo sapiens)	8554872	ClinVar Annotator: match by term: Carey-Fineman-Ziter syndrome 1	ClinVar	PMID:25741868
MYMK	Human	developmental and epileptic encephalopathy 14		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 14	ClinVar	PMID:28492532
MYMK	Human	Ehlers-Danlos syndrome classic type 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Ehlers-Danlos syndrome and classic type	ClinVar	PMID:28492532
MYMK	Human	genetic disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
MYMK	Human	genetic disease		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
MYMK	Human	Kleefstra syndrome 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Kleefstra syndrome 1	ClinVar	PMID:22318994 more ...
MYMK	Human	Leigh disease		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:28492532
MYMK	Human	primary coenzyme Q10 deficiency 7		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome	ClinVar	PMID:28492532
MYMK	Human	Rafiq syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Rafiq syndrome	ClinVar	PMID:28492532
MYMK	Human	tuberous sclerosis 1		IAGP	(Homo sapiens) more ...	8554872	ClinVar Annotator: match by term: Tuberous sclerosis 1	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	Carey-Fineman-Ziter Syndrome 1		IAGP		7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	1,2-dimethylhydrazine	decreases expression	ISO	Mymk (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of TMEM8C mRNA	CTD	PMID:22206623
MYMK	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Mymk (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of MYMK mRNA	CTD	PMID:32109520
MYMK	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Mymk (Mus musculus)	6480464	bisphenol S results in increased expression of TMEM8C mRNA	CTD	PMID:30951980
MYMK	Human	bisphenol A	decreases expression	ISO	Mymk (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of MYMK mRNA	CTD	PMID:25181051
MYMK	Human	bisphenol F	increases expression	ISO	Mymk (Mus musculus)	6480464	bisphenol F results in increased expression of TMEM8C mRNA	CTD	PMID:30951980
MYMK	Human	carbon nanotube	increases expression	ISO	Mymk (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
MYMK	Human	ozone	increases expression	ISO	Mymk (Mus musculus)	6480464	Ozone results in increased expression of MYMK mRNA	CTD	PMID:31626304
MYMK	Human	sodium arsenite	increases expression	ISO	Mymk (Mus musculus)	6480464	sodium arsenite results in increased expression of MYMK mRNA	CTD	PMID:37682722
MYMK	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of MYMK mRNA	CTD	PMID:31533062
MYMK	Human	titanium dioxide	decreases expression	ISO	Mymk (Mus musculus)	6480464	titanium dioxide results in decreased expression of TMEM8C mRNA	CTD	PMID:29264374
MYMK	Human	triclosan	increases expression	EXP		6480464	Triclosan results in increased expression of TMEM8C mRNA	CTD	PMID:30510588
MYMK	Human	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of MYMK gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	muscle organ development	involved_in	IEA	UniProtKB-KW:KW-0517	150520179		UniProt	GO_REF:0000043
MYMK	Human	myoblast fusion	involved_in	IDA		150520179	PMID:28681861	UniProt	PMID:28681861
MYMK	Human	myoblast fusion	involved_in	ISS	UniProtKB:Q9D1N4	150520179		UniProt	GO_REF:0000024
MYMK	Human	myoblast fusion	involved_in	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	myoblast fusion involved in skeletal muscle regeneration	acts_upstream_of_or_within	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	plasma membrane fusion	involved_in	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	plasma membrane fusion	involved_in	ISS	UniProtKB:Q9D1N4	150520179		UniProt	GO_REF:0000024
MYMK	Human	positive regulation of skeletal muscle hypertrophy	involved_in	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	positive regulation of skeletal muscle hypertrophy	involved_in	ISS	UniProtKB:Q9D1N4	150520179		UniProt	GO_REF:0000024
MYMK	Human	skeletal muscle tissue regeneration	acts_upstream_of_or_within	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	150520179		UniProt	GO_REF:0000043
MYMK	Human	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	150520179		UniProt	GO_REF:0000044
MYMK	Human	Golgi membrane	located_in	ISS	UniProtKB:Q9D1N4	150520179		UniProt	GO_REF:0000024
MYMK	Human	Golgi membrane	located_in	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	membrane	located_in	IEA	InterPro:IPR021910	150520179		InterPro	GO_REF:0000002
MYMK	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
MYMK	Human	plasma membrane	located_in	IDA		150520179	PMID:28681861	UniProt	PMID:28681861
MYMK	Human	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
MYMK	Human	plasma membrane	located_in	ISS	UniProtKB:Q9D1N4	150520179		UniProt	GO_REF:0000024
MYMK	Human	plasma membrane	located_in	IEA	UniProtKB:Q9D1N4 and ensembl:ENSMUSP00000009358	150520179		Ensembl	GO_REF:0000107
MYMK	Human	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	protein binding	enables	ISO	UniProtKB:Q2Q5T5	9068941	PMID:28386024	UniProt	PMID:28386024

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
MYMK	Human	Abducens palsy		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Abnormal cardiac septum morphology		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Abnormality of the larynx		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Anteverted nares		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Anteverted nares		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Aplasia of the pectoralis major muscle		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Aplasia/Hypoplasia of the cerebellum		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Aplasia/Hypoplasia of the tongue		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Autosomal recessive inheritance		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Bowel irritability		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Brachydactyly		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Broad nasal tip		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Cataract		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Cerebral calcification		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Cleft palate		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Cleft palate		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Cranial nerve paralysis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Cryptorchidism		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Decreased fetal movement		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Depressed nasal bridge		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Distal muscle weakness		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Downslanted palpebral fissures		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Downslanted palpebral fissures		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Dysphagia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Elevated circulating creatine kinase concentration		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Epicanthus		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Epicanthus		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Facial palsy		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Facial palsy		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Failure to thrive		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Feeding difficulties		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Flexion contracture		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Gastroesophageal reflux		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Generalized hypotonia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Glanular hypospadias		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Glaucoma		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Global developmental delay		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Glossoptosis		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Glossoptosis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Growth delay		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Growth delay		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	High palate		IAGP		8699517		HPO	MIM:254940
MYMK	Human	High palate		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Hydronephrosis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Hypertensive crisis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Hypoplasia of the brainstem		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Hypoplasia of the musculature		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Hypotonia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Hypotonia		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Impaired ocular abduction		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Infantile onset		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Intellectual disability		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Intellectual disability		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Juvenile onset		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Lagophthalmos		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Laryngeal stenosis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Long philtrum		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Macrocephaly		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Microcephaly		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Microcephaly		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Microglossia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Micrognathia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Micrognathia		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Motor delay		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Myopathy		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Myopathy		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Oculomotor nerve palsy		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Ophthalmoplegia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Pectoralis hypoplasia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Pierre-Robin sequence		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Pierre-Robin sequence		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Plagiocephaly		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Proximal muscle weakness		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Ptosis		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Ptosis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Pulmonary arterial hypertension		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Respiratory insufficiency		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Retrognathia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Scoliosis		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Scoliosis		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Seizure		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Sensorineural hearing impairment		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Severe muscular hypotonia		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Short nose		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Short stature		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Skeletal muscle atrophy		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Skeletal muscle atrophy		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Slowly progressive		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Spinal rigidity		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Talipes equinovarus		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Talipes equinovarus		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Tapered finger		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Thin vermilion border		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Trismus		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Ulnar deviation of finger		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Ventriculomegaly		IAGP		8699517		HPO	MIM:254940
MYMK	Human	Ventriculomegaly		IAGP		8699517		HPO	ORPHA:1358
MYMK	Human	Weakness of facial musculature		IAGP		8699517		HPO	MIM:254940

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:21873635	PMID:28681861	PMID:29560417	PMID:31642939	PMID:34288723

MYMK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	133,514,586 - 133,524,959 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	133,514,586 - 133,528,612 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	136,379,708 - 136,390,081 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	135,369,579 - 135,379,787 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Cytogenetic Map	9	q34.2	NCBI
HuRef	9	105,880,949 - 105,891,314 (-)	NCBI		HuRef
CHM1_1	9	136,529,867 - 136,540,211 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	145,728,593 - 145,738,968 (-)	NCBI		T2T-CHM13v2.0

Mymk
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	26,951,648 - 26,962,173 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	26,951,648 - 26,962,191 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	27,061,636 - 27,072,161 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	27,061,636 - 27,072,179 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	26,917,156 - 26,927,681 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	26,883,682 - 26,894,170 (-)	NCBI		MGSCv36	mm8
Celera	2	26,764,277 - 26,775,219 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	19.21	NCBI

Mymk
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	30,786,443 - 30,795,374 (-)	NCBI		GRCr8
mRatBN7.2	3	10,388,363 - 10,397,294 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	10,388,361 - 10,397,343 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	13,453,976 - 13,462,907 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	22,039,374 - 22,048,305 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	20,294,674 - 20,303,605 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	5,608,243 - 5,617,689 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	5,608,243 - 5,617,225 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	10,970,626 - 10,979,608 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	5,957,947 - 5,966,929 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	5,958,805 - 5,967,234 (-)	NCBI
Celera	3	5,186,642 - 5,195,624 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

Mymk
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	2,833,234 - 2,842,325 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	2,835,466 - 2,842,325 (-)	NCBI	ChiLan1.0	ChiLan1.0

MYMK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	5,808,338 - 5,838,538 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	5,810,674 - 5,840,870 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	104,638,011 - 104,668,204 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	133,248,761 - 133,259,631 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	133,248,761 - 133,259,631 (-)	Ensembl	panpan1.1		panPan2

MYMK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	49,905,580 - 49,919,849 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	49,907,228 - 49,921,007 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	49,188,745 - 49,200,929 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	50,781,759 - 50,793,959 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	50,781,326 - 50,791,690 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	49,543,510 - 49,555,688 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	49,885,340 - 49,897,530 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	49,963,490 - 49,975,710 (-)	NCBI		UU_Cfam_GSD_1.0

Mymk
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	199,961,922 - 199,970,359 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936669	3,404,704 - 3,413,136 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936669	3,404,729 - 3,413,123 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYMK
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	273,101,678 - 273,111,727 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	273,101,674 - 273,111,721 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	307,075,501 - 307,086,445 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MYMK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	4,611,952 - 4,623,373 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	4,612,268 - 4,622,381 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	366,360 - 377,331 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mymk
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	1,934,699 - 1,941,149 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	1,934,223 - 1,941,176 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in MYMK
63 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000050348]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9q33.2-34.3(chr9:121112395-138075224)x3	copy number gain	See cases [RCV000051009]	Chr9:121112395..138075224 [GRCh38] Chr9:123874673..140969676 [GRCh37] Chr9:122914494..140089497 [NCBI36] Chr9:9q33.2-34.3	pathogenic
GRCh38/hg38 9q33.2-34.3(chr9:122792658-138124532)x3	copy number gain	See cases [RCV000051040]	Chr9:122792658..138124532 [GRCh38] Chr9:125554937..141018984 [GRCh37] Chr9:124594758..140138805 [NCBI36] Chr9:9q33.2-34.3	pathogenic
GRCh38/hg38 9q34.2(chr9:133504071-133777922)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052259]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052259]\|See cases [RCV000052259]	Chr9:133504071..133777922 [GRCh38] Chr9:136324358..136643044 [GRCh37] Chr9:135314179..135632865 [NCBI36] Chr9:9q34.2	uncertain significance
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124532)x3	copy number gain	See cases [RCV000053745]	Chr9:193412..138124532 [GRCh38] Chr9:204193..141018984 [GRCh37] Chr9:194193..140138805 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9q34.11-34.3(chr9:129068560-136495351)x3	copy number gain	See cases [RCV000053779]	Chr9:129068560..136495351 [GRCh38] Chr9:131830839..139389803 [GRCh37] Chr9:130870660..138509624 [NCBI36] Chr9:9q34.11-34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138114463)x3	copy number gain	See cases [RCV000053746]	Chr9:193412..138114463 [GRCh38] Chr9:214367..141008915 [GRCh37] Chr9:204367..140128736 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|See cases [RCV000053748]	Chr9:193412..138179445 [GRCh38] Chr9:266045..141073897 [GRCh37] Chr9:256045..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9q34.13-34.2(chr9:131406683-133852779)x4	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053812]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053812]\|See cases [RCV000053812]	Chr9:131406683..133852779 [GRCh38] Chr9:134282070..136717901 [GRCh37] Chr9:133271891..135707722 [NCBI36] Chr9:9q34.13-34.2	pathogenic
GRCh38/hg38 9q33.2-34.3(chr9:121586837-138179445)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053776]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053776]\|See cases [RCV000053776]	Chr9:121586837..138179445 [GRCh38] Chr9:124349116..141073897 [GRCh37] Chr9:123388937..140193718 [NCBI36] Chr9:9q33.2-34.3	pathogenic
NM_001080483.2(TMEM8C):c.136-2179C>T	single nucleotide variant	Lung cancer [RCV000108187]	Chr9:133522467 [GRCh38] Chr9:136387589 [GRCh37] Chr9:9q34.2	uncertain significance
GRCh38/hg38 9p24.3-q34.3(chr9:204193-138179445)	copy number gain	See cases [RCV000133791]	Chr9:204193..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9q34.11-34.3(chr9:130513207-138124532)x3	copy number gain	See cases [RCV000133778]	Chr9:130513207..138124532 [GRCh38] Chr9:133388594..141018984 [GRCh37] Chr9:132378415..140138805 [NCBI36] Chr9:9q34.11-34.3	pathogenic
GRCh38/hg38 9q34.11-34.3(chr9:129068560-138179445)x3	copy number gain	See cases [RCV000134916]	Chr9:129068560..138179445 [GRCh38] Chr9:131830839..141073897 [GRCh37] Chr9:130870660..140193718 [NCBI36] Chr9:9q34.11-34.3	pathogenic
GRCh38/hg38 9q33.2-34.3(chr9:121073102-138179445)x3	copy number gain	See cases [RCV000134920]	Chr9:121073102..138179445 [GRCh38] Chr9:123835380..141073897 [GRCh37] Chr9:122875201..140193718 [NCBI36] Chr9:9q33.2-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:132986903-138114463)x3	copy number gain	See cases [RCV000136790]	Chr9:132986903..138114463 [GRCh38] Chr9:135862290..141008915 [GRCh37] Chr9:134852111..140128736 [NCBI36] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.2-34.3(chr9:133504071-138159073)x3	copy number gain	See cases [RCV000137825]	Chr9:133504071..138159073 [GRCh38] Chr9:136324358..141053525 [GRCh37] Chr9:135314179..140173346 [NCBI36] Chr9:9q34.2-34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124524)x3	copy number gain	See cases [RCV000138783]	Chr9:193412..138124524 [GRCh38] Chr9:204090..141018976 [GRCh37] Chr9:194090..140138797 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p11.2-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000139207]	Chr9:193412..138159073 [GRCh38] Chr9:68420641..141053525 [GRCh37] Chr9:67910461..140173346 [NCBI36] Chr9:9p11.2-q34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000138962]	Chr9:193412..138159073 [GRCh38] Chr9:204104..141053525 [GRCh37] Chr9:194104..140173346 [NCBI36] Chr9:9p24.3-q34.3	pathogenic\|conflicting data from submitters
GRCh38/hg38 9p24.3-q34.3(chr9:203861-138125937)x3	copy number gain	See cases [RCV000141876]	Chr9:203861..138125937 [GRCh38] Chr9:203861..141020389 [GRCh37] Chr9:193861..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:132386553-138059695)x3	copy number gain	See cases [RCV000142636]	Chr9:132386553..138059695 [GRCh38] Chr9:135261940..140954147 [GRCh37] Chr9:134251761..140073968 [NCBI36] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:203862-138125937)x3	copy number gain	See cases [RCV000143476]	Chr9:203862..138125937 [GRCh38] Chr9:203862..141020389 [GRCh37] Chr9:193862..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000148113]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:163131-141122114)x3	copy number gain	See cases [RCV000240081]	Chr9:163131..141122114 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
NM_001080483.3(MYMK):c.481G>C (p.Gly161Arg)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001270899]	Chr9:133515526 [GRCh38] Chr9:136380648 [GRCh37] Chr9:9q34.2	uncertain significance
GRCh37/hg19 9p24.3-q34.3(chr9:62525-141006407)	copy number gain	See cases [RCV000449375]	Chr9:62525..141006407 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020389)x3	copy number gain	not specified [RCV003986800]	Chr9:203861..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9q33.3-34.3(chr9:128652785-141044751)x3	copy number gain	See cases [RCV000447080]	Chr9:128652785..141044751 [GRCh37] Chr9:9q33.3-34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203864-141020389)x3	copy number gain	See cases [RCV000448978]	Chr9:203864..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9q33.2-34.3(chr9:124642754-141146461)x3	copy number gain	See cases [RCV000448784]	Chr9:124642754..141146461 [GRCh37] Chr9:9q33.2-34.3	pathogenic
NM_001080483.3(MYMK):c.2T>A (p.Met1Lys)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV000495944]	Chr9:133524843 [GRCh38] Chr9:136389965 [GRCh37] Chr9:9q34.2	pathogenic
NM_001080483.3(MYMK):c.553T>C (p.Cys185Arg)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV000495947]	Chr9:133514749 [GRCh38] Chr9:136379871 [GRCh37] Chr9:9q34.2	pathogenic
NM_001080483.3(MYMK):c.298G>A (p.Gly100Ser)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV000495951]\|See cases [RCV002252140]	Chr9:133518975 [GRCh38] Chr9:136384097 [GRCh37] Chr9:9q34.2	pathogenic\|likely pathogenic
NM_001080483.3(MYMK):c.271C>A (p.Pro91Thr)	single nucleotide variant	Carey-Fineman-Ziter syndrome 1 [RCV003147484]\|Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV000495954]\|MYMK-related disorder [RCV003424047]\|not provided [RCV001575718]	Chr9:133519002 [GRCh38] Chr9:136384124 [GRCh37] Chr9:9q34.2	pathogenic\|likely pathogenic\|conflicting interpretations of pathogenicity\|uncertain significance\|no classifications from unflagged records
NM_001080483.3(MYMK):c.461T>C (p.Ile154Thr)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV000495946]	Chr9:133515546 [GRCh38] Chr9:136380668 [GRCh37] Chr9:9q34.2	pathogenic
GRCh37/hg19 9q21.11-34.3(chr9:71069743-140999928)	copy number gain	Global developmental delay [RCV000626548]	Chr9:71069743..140999928 [GRCh37] Chr9:9q21.11-34.3	likely pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203862-141020389)	copy number gain	See cases [RCV000512392]	Chr9:203862..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9q34.13-34.3(chr9:135377559-141213431)x1	copy number loss	mTOR Inhibitor response [RCV000626442]	Chr9:135377559..141213431 [GRCh37] Chr9:9q34.13-34.3	drug response
GRCh37/hg19 9q34.13-34.3(chr9:135105971-141020389)x3	copy number gain	not provided [RCV000683160]	Chr9:135105971..141020389 [GRCh37] Chr9:9q34.13-34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141122247)x3	copy number gain	not provided [RCV000748055]	Chr9:10590..141122247 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9q34.2(chr9:136310908-136452144)x1	copy number loss	not provided [RCV000748743]	Chr9:136310908..136452144 [GRCh37] Chr9:9q34.2	benign
GRCh37/hg19 9q34.2(chr9:136351927-136402067)x3	copy number gain	not provided [RCV000748744]	Chr9:136351927..136402067 [GRCh37] Chr9:9q34.2	benign
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141107672)x3	copy number gain	not provided [RCV000748053]	Chr9:10590..141107672 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:46587-141066491)x3	copy number gain	not provided [RCV000748063]	Chr9:46587..141066491 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141114095)x2	copy number gain	not provided [RCV000748054]	Chr9:10590..141114095 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
NM_001080483.3(MYMK):c.253C>T (p.Leu85=)	single nucleotide variant	not provided [RCV000963929]	Chr9:133519020 [GRCh38] Chr9:136384142 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.642C>T (p.Ser214=)	single nucleotide variant	not provided [RCV000982722]	Chr9:133514660 [GRCh38] Chr9:136379782 [GRCh37] Chr9:9q34.2	likely benign
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020388)x3	copy number gain	not provided [RCV000845900]	Chr9:203861..141020388 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
NM_001080483.3(MYMK):c.219G>A (p.Gly73=)	single nucleotide variant	not provided [RCV000970202]	Chr9:133520205 [GRCh38] Chr9:136385327 [GRCh37] Chr9:9q34.2	benign\|likely benign
NM_001080483.3(MYMK):c.480C>T (p.Phe160=)	single nucleotide variant	not provided [RCV000942341]	Chr9:133515527 [GRCh38] Chr9:136380649 [GRCh37] Chr9:9q34.2	likely benign
NC_000009.11:g.(?_134379574)_(138678377_?)dup	duplication	Ehlers-Danlos syndrome, classic type [RCV000807925]	Chr9:134379574..138678377 [GRCh37] Chr9:9q34.13-34.3	uncertain significance
GRCh37/hg19 9q21.11-34.3(chr9:71416475-141020389)x3	copy number gain	not provided [RCV000847808]	Chr9:71416475..141020389 [GRCh37] Chr9:9q21.11-34.3	pathogenic
NM_001080483.3(MYMK):c.165G>C (p.Leu55Phe)	single nucleotide variant	Inborn genetic diseases [RCV003240637]	Chr9:133520259 [GRCh38] Chr9:136385381 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.253C>A (p.Leu85Met)	single nucleotide variant	Inborn genetic diseases [RCV003239778]	Chr9:133519020 [GRCh38] Chr9:136384142 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.-49T>C	single nucleotide variant	not provided [RCV001688820]	Chr9:133524893 [GRCh38] Chr9:136390015 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.135+179A>G	single nucleotide variant	not provided [RCV001620131]	Chr9:133524531 [GRCh38] Chr9:136389653 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.190G>A (p.Asp64Asn)	single nucleotide variant	not provided [RCV001551885]	Chr9:133520234 [GRCh38] Chr9:136385356 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.251-18T>C	single nucleotide variant	not provided [RCV001541252]	Chr9:133519040 [GRCh38] Chr9:136384162 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.399+27C>G	single nucleotide variant	not provided [RCV001617544]	Chr9:133518847 [GRCh38] Chr9:136383969 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.267C>T (p.Asp89=)	single nucleotide variant	not provided [RCV000930226]	Chr9:133519006 [GRCh38] Chr9:136384128 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.348G>C (p.Gly116=)	single nucleotide variant	not provided [RCV000930019]	Chr9:133518925 [GRCh38] Chr9:136384047 [GRCh37] Chr9:9q34.2	likely benign
NM_001080483.3(MYMK):c.615G>A (p.Pro205=)	single nucleotide variant	not provided [RCV000918491]	Chr9:133514687 [GRCh38] Chr9:136379809 [GRCh37] Chr9:9q34.2	benign
NC_000009.11:g.(?_135771602)_(136769889_?)dup	duplication	Tuberous sclerosis 1 [RCV001033460]	Chr9:135771602..136769889 [GRCh37] Chr9:9q34.13-34.2	uncertain significance
NM_001080483.3(MYMK):c.468C>T (p.Pro156=)	single nucleotide variant	not provided [RCV000890513]	Chr9:133515539 [GRCh38] Chr9:136380661 [GRCh37] Chr9:9q34.2	likely benign
NM_001080483.3(MYMK):c.300C>T (p.Gly100=)	single nucleotide variant	not provided [RCV000933960]	Chr9:133518973 [GRCh38] Chr9:136384095 [GRCh37] Chr9:9q34.2	likely benign
NM_001080483.3(MYMK):c.517-4G>A	single nucleotide variant	Inborn genetic diseases [RCV004028397]\|not provided [RCV000890572]	Chr9:133514789 [GRCh38] Chr9:136379911 [GRCh37] Chr9:9q34.2	likely benign
NC_000009.11:g.(?_135771850)_(137038881_?)dup	duplication	Tuberous sclerosis 1 [RCV001033564]	Chr9:135771850..137038881 [GRCh37] Chr9:9q34.13-34.2	uncertain significance
NM_001080483.3(MYMK):c.517-169T>G	single nucleotide variant	not provided [RCV001710286]	Chr9:133514954 [GRCh38] Chr9:136380076 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.399+361A>G	single nucleotide variant	not provided [RCV001680121]	Chr9:133518513 [GRCh38] Chr9:136383635 [GRCh37] Chr9:9q34.2	benign
NC_000009.12:g.133524994T>G	single nucleotide variant	not provided [RCV001665632]	Chr9:133524994 [GRCh38] Chr9:136390116 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.517-208T>G	single nucleotide variant	not provided [RCV001611094]	Chr9:133514993 [GRCh38] Chr9:136380115 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.136-27T>C	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001838702]\|not provided [RCV001611502]	Chr9:133520315 [GRCh38] Chr9:136385437 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.135+81T>G	single nucleotide variant	not provided [RCV001648472]	Chr9:133524629 [GRCh38] Chr9:136389751 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.399+5G>A	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001004946]\|not provided [RCV001766821]	Chr9:133518869 [GRCh38] Chr9:136383991 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.305T>C (p.Leu102Pro)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001089958]	Chr9:133518968 [GRCh38] Chr9:136384090 [GRCh37] Chr9:9q34.2	likely pathogenic
NM_001080483.3(MYMK):c.242C>T (p.Ser81Leu)	single nucleotide variant	not provided [RCV001549477]	Chr9:133520182 [GRCh38] Chr9:136385304 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.482_483insCCCA (p.Ala162fs)	insertion	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001267695]	Chr9:133515524..133515525 [GRCh38] Chr9:136380646..136380647 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.162del (p.Leu55fs)	deletion	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001333720]	Chr9:133520262 [GRCh38] Chr9:136385384 [GRCh37] Chr9:9q34.2	pathogenic
NM_001080483.3(MYMK):c.535G>A (p.Val179Ile)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001332769]	Chr9:133514767 [GRCh38] Chr9:136379889 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.534T>C (p.Tyr178=)	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001838682]\|not provided [RCV001537062]	Chr9:133514768 [GRCh38] Chr9:136379890 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.136-144C>T	single nucleotide variant	not provided [RCV001619287]	Chr9:133520432 [GRCh38] Chr9:136385554 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.136-43T>C	single nucleotide variant	Congenital nonprogressive myopathy with Moebius and Robin sequences [RCV001838753]\|not provided [RCV001669715]	Chr9:133520331 [GRCh38] Chr9:136385453 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.250+208T>G	single nucleotide variant	not provided [RCV001681263]	Chr9:133519966 [GRCh38] Chr9:136385088 [GRCh37] Chr9:9q34.2	benign
NM_001080483.3(MYMK):c.365T>C (p.Ile122Thr)	single nucleotide variant	not provided [RCV001771319]	Chr9:133518908 [GRCh38] Chr9:136384030 [GRCh37] Chr9:9q34.2	uncertain significance
GRCh37/hg19 9p24.3-q34.3(chr9:353349-141020389)	copy number gain	not specified [RCV002053823]	Chr9:353349..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
NC_000009.11:g.(?_135139626)_(140034216_?)dup	duplication	Developmental and epileptic encephalopathy, 14 [RCV003111109]\|Leigh syndrome [RCV003122287]\|Rafiq syndrome [RCV003122286]\|Tuberous sclerosis 1 [RCV003111108]	Chr9:135139626..140034216 [GRCh37] Chr9:9q34.13-34.3	uncertain significance
NC_000009.11:g.(?_131087402)_(141016451_?)dup	duplication	Neonatal encephalomyopathy-cardiomyopathy-respiratory distress syndrome [RCV003119700]	Chr9:131087402..141016451 [GRCh37] Chr9:9q34.11-34.3	uncertain significance
NC_000009.11:g.(?_136218768)_(141016451_?)dup	duplication	Kleefstra syndrome 1 [RCV003122719]	Chr9:136218768..141016451 [GRCh37] Chr9:9q34.2-34.3	uncertain significance
NM_001080483.3(MYMK):c.8C>T (p.Thr3Met)	single nucleotide variant	Carey-Fineman-Ziter syndrome 1 [RCV003132789]\|MYMK-related disorder [RCV003906659]	Chr9:133524837 [GRCh38] Chr9:136389959 [GRCh37] Chr9:9q34.2	benign\|uncertain significance
NM_001080483.3(MYMK):c.565A>G (p.Met189Val)	single nucleotide variant	Inborn genetic diseases [RCV003262985]	Chr9:133514737 [GRCh38] Chr9:136379859 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.506T>G (p.Phe169Cys)	single nucleotide variant	Inborn genetic diseases [RCV003356250]	Chr9:133515501 [GRCh38] Chr9:136380623 [GRCh37] Chr9:9q34.2	uncertain significance
GRCh37/hg19 9q34.2(chr9:136378366-136726628)x3	copy number gain	not provided [RCV003484785]	Chr9:136378366..136726628 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.542G>A (p.Ser181Asn)	single nucleotide variant	MYMK-related disorder [RCV003399973]	Chr9:133514760 [GRCh38] Chr9:136379882 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.159del (p.Gly54fs)	deletion	not provided [RCV003443271]	Chr9:133520265 [GRCh38] Chr9:136385387 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.243G>A (p.Ser81=)	single nucleotide variant	not provided [RCV003430375]	Chr9:133520181 [GRCh38] Chr9:136385303 [GRCh37] Chr9:9q34.2	likely benign
NM_001080483.3(MYMK):c.159C>T (p.Pro53=)	single nucleotide variant	not provided [RCV003884920]	Chr9:133520265 [GRCh38] Chr9:136385387 [GRCh37] Chr9:9q34.2	likely benign
NM_001080483.3(MYMK):c.265G>A (p.Asp89Asn)	single nucleotide variant	Inborn genetic diseases [RCV004453192]	Chr9:133519008 [GRCh38] Chr9:136384130 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.32C>A (p.Pro11His)	single nucleotide variant	Inborn genetic diseases [RCV004453200]	Chr9:133524813 [GRCh38] Chr9:136389935 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.86G>A (p.Arg29Gln)	single nucleotide variant	Inborn genetic diseases [RCV004453221]	Chr9:133524759 [GRCh38] Chr9:136389881 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.250+6T>G	single nucleotide variant	Inborn genetic diseases [RCV004453183]	Chr9:133520168 [GRCh38] Chr9:136385290 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.418A>C (p.Lys140Gln)	single nucleotide variant	Inborn genetic diseases [RCV004453202]	Chr9:133515589 [GRCh38] Chr9:136380711 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.160G>A (p.Gly54Ser)	single nucleotide variant	Inborn genetic diseases [RCV004453176]	Chr9:133520264 [GRCh38] Chr9:136385386 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.614C>T (p.Pro205Leu)	single nucleotide variant	Inborn genetic diseases [RCV004453217]	Chr9:133514688 [GRCh38] Chr9:136379810 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.316G>A (p.Val106Met)	single nucleotide variant	Inborn genetic diseases [RCV004453195]	Chr9:133518957 [GRCh38] Chr9:136384079 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.542G>C (p.Ser181Thr)	single nucleotide variant	Inborn genetic diseases [RCV004453210]	Chr9:133514760 [GRCh38] Chr9:136379882 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.486G>C (p.Ala162=)	single nucleotide variant	not provided [RCV004575005]	Chr9:133515521 [GRCh38] Chr9:136380643 [GRCh37] Chr9:9q34.2	likely benign
NC_000009.11:g.(?_131678355)_(140095163_?)dup	duplication	not provided [RCV004582063]	Chr9:131678355..140095163 [GRCh37] Chr9:9q34.11-34.3	uncertain significance
NM_001080483.3(MYMK):c.428T>C (p.Leu143Pro)	single nucleotide variant	Carey-Fineman-Ziter syndrome 1 [RCV004586430]	Chr9:133515579 [GRCh38] Chr9:136380701 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.264C>G (p.Phe88Leu)	single nucleotide variant	Inborn genetic diseases [RCV004649850]	Chr9:133519009 [GRCh38] Chr9:136384131 [GRCh37] Chr9:9q34.2	uncertain significance
GRCh38/hg38 9q34.13-34.3(chr9:136926151-138059181)	copy number loss	Kleefstra syndrome 1 [RCV004720480]	Chr9:136926151..138059181 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137552082-137728529)	copy number loss	Kleefstra syndrome 1 [RCV004720485]	Chr9:137552082..137728529 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137590213-138052188)	copy number loss	Kleefstra syndrome 1 [RCV004720477]	Chr9:137590213..138052188 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137590213-137817525)	copy number loss	Kleefstra syndrome 1 [RCV004720478]	Chr9:137590213..137817525 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137552409-138052113)	copy number loss	Kleefstra syndrome 1 [RCV004720482]	Chr9:137552409..138052113 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137552409-138059181)	copy number loss	Kleefstra syndrome 1 [RCV004720481]	Chr9:137552409..138059181 [GRCh38] Chr9:9q34.13-34.3	pathogenic
GRCh38/hg38 9q34.13-34.3(chr9:137552409-137879159)	copy number loss	Kleefstra syndrome 1 [RCV004720487]	Chr9:137552409..137879159 [GRCh38] Chr9:9q34.13-34.3	pathogenic
NM_001080483.3(MYMK):c.319C>T (p.Arg107Trp)	single nucleotide variant	Inborn genetic diseases [RCV004959035]	Chr9:133518954 [GRCh38] Chr9:136384076 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.505T>C (p.Phe169Leu)	single nucleotide variant	Inborn genetic diseases [RCV004959036]	Chr9:133515502 [GRCh38] Chr9:136380624 [GRCh37] Chr9:9q34.2	uncertain significance
NM_001080483.3(MYMK):c.278G>A (p.Arg93Lys)	single nucleotide variant	Inborn genetic diseases [RCV004959034]	Chr9:133518995 [GRCh38] Chr9:136384117 [GRCh37] Chr9:9q34.2	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	760
Count of miRNA genes:	551
Interacting mature miRNAs:	606
Transcripts:	ENST00000339996, ENST00000413714
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597328458	GWAS1424532_H	sexual dimorphism measurement QTL GWAS1424532 (human)		1e-08	sexual dimorphism measurement		9	133518025	133518026	Human
597250576	GWAS1346650_H	alkaline phosphatase measurement QTL GWAS1346650 (human)		2e-28	alkaline phosphatase measurement	blood alkaline phosphatase activity level (CMO:0000576)	9	133523357	133523358	Human
597252709	GWAS1348783_H	alkaline phosphatase measurement QTL GWAS1348783 (human)		2e-18	alkaline phosphatase measurement	blood alkaline phosphatase activity level (CMO:0000576)	9	133522677	133522678	Human
597264836	GWAS1360910_H	factor VIII measurement QTL GWAS1360910 (human)		9e-13	factor VIII measurement		9	133514768	133514769	Human
597223910	GWAS1319984_H	blood group A QTL GWAS1319984 (human)		5e-08	blood group A		9	133523580	133523581	Human
597125753	GWAS1221827_H	appendicular lean mass QTL GWAS1221827 (human)		8e-11	appendicular lean mass		9	133524893	133524894	Human
596977754	GWAS1097273_H	body height QTL GWAS1097273 (human)		2e-18	body height		9	133519966	133519967	Human

D9S1268

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	136,385,959 - 136,386,093	UniSTS	GRCh37
Build 36	9	135,375,780 - 135,375,914	RGD	NCBI36
Cytogenetic Map	9	q34.2	UniSTS
HuRef	9	105,887,200 - 105,887,334	UniSTS

D9S1311

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	136,386,866 - 136,387,019	UniSTS	GRCh37
Build 36	9	135,376,687 - 135,376,840	RGD	NCBI36
Cytogenetic Map	9	q34.2	UniSTS
HuRef	9	105,888,107 - 105,888,260	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
331	576	1556	680	2671	919	1192	2	252	427	206	811	2524	1876	10	2517	393	962	875	50	1


RefSeq Transcripts	NM_001080483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BX324209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000339996 ⟹ ENSP00000419712

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	9	133,514,586 - 133,524,959 (-)	Ensembl

Ensembl Acc Id:

ENST00000413714

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	9	133,515,531 - 133,528,612 (-)	Ensembl

RefSeq Acc Id:

NM_001080483 ⟹ NP_001073952

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	9	133,514,586 - 133,524,959 (-)	NCBI
GRCh37	9	136,379,708 - 136,390,068 (-)	RGD
Build 36	9	135,369,579 - 135,379,787 (-)	NCBI Archive
HuRef	9	105,880,949 - 105,891,314 (-)	ENTREZGENE
CHM1_1	9	136,529,867 - 136,540,211 (-)	NCBI
T2T-CHM13v2.0	9	145,728,593 - 145,738,968 (-)	NCBI

Sequence:

show sequence

AGCTGCCATCAGAGCCCTGCCCAAAGGGAGCTGGCCTTCCCACTTCGTGCTCCTGTGCTGGGGACCTGGGACACCAGCACCCTCCCCACCCCAGCCAGTGCTTTCCTCCTGGCCCATGGGGACGCTGG
TGGCCAAGCTGCTCCTGCCCACCCTCAGCAGCCTGGCCTTCCTCCCCACTGTCAGCATCGCGGCCAAGAGGCGGTTCCACATGGAGGCCATGGTCTACCTCTTCACCCTGTTCTTCGTGGCGCTCCAC
CATGCCTGCAATGGACCCGGCTTGTCTGTGCTGTGCTTCATGCGTCACGACATCCTGGAGTATTTCAGTGTCTACGGGACAGCCCTGAGCATGTGGGTCTCGCTGATGGCACTGGCCGACTTCGACGA
ACCCAAGAGGTCAACATTTGTGATGTTCGGCGTCCTGACCATTGCTGTGCGGATCTACCATGACCGATGGGGCTACGGGGTGTACTCGGGCCCCATCGGCACAGCCATCCTCATCATCGCGGCAAAGT
GGCTACAGAAGATGAAGGAGAAGAAGGGCCTGTACCCAGACAAGAGCGTCTACACCCAGCAGATAGGCCCCGGCCTCTGCTTCGGGGCGCTGGCCCTGATGCTACGCTTCTTCTTTGAGGACTGGGAC
TACACTTATGTCCACAGCTTCTACCACTGTGCCCTGGCTATGTCCTTTGTTCTGCTGCTGCCCAAGGTCAACAAGAAGGCTGGATCCCCGGGGACCCCGGCCAAGCTGGACTGCTCCACCCTGTGCTG
TGCTTGTGTCTGATGCTGCGCCCAGCCCGGCTCTGAGCCCCTGCCCTCCCCAGCTCACACTTG

hide sequence


Protein RefSeqs	NP_001073952	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A6NI61	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000419712
	ENSP00000419712.2

RefSeq Acc Id:

NP_001073952 ⟸ NM_001080483

- UniProtKB:

A6NI61 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILI
IAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTLCCACV

hide sequence

Ensembl Acc Id:

ENSP00000419712 ⟸ ENST00000339996

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A6NI61-F1-model_v2	AlphaFold	A6NI61	1-221	view protein structure

Database	Acc Id	Source(s)
COSMIC	MYMK	COSMIC
Ensembl Genes	ENSG00000187616	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000339996	ENTREZGENE
	ENST00000339996.4	UniProtKB/Swiss-Prot
GTEx	ENSG00000187616	GTEx
HGNC ID	HGNC:33778	ENTREZGENE
Human Proteome Map	MYMK	Human Proteome Map
InterPro	NGX6/PGAP6/MYMK	UniProtKB/Swiss-Prot
KEGG Report	hsa:389827	UniProtKB/Swiss-Prot
NCBI Gene	389827	ENTREZGENE
OMIM	615345	OMIM
PANTHER	POST-GPI ATTACHMENT TO PROTEINS FACTOR 6	UniProtKB/Swiss-Prot
	PTHR14319	UniProtKB/Swiss-Prot
Pfam	DUF3522	UniProtKB/Swiss-Prot
PharmGKB	PA165586306	PharmGKB
UniProt	A6NI61	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-05-16	MYMK	myomaker, myoblast fusion factor	TMEM8C	transmembrane protein 8C	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Human Phenotype Annotations - HPO

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Human Phenotype Annotations - HPO