Symbol:
Pcsk1
Name:
proprotein convertase subtilisin/kexin type 1
RGD ID:
3272
Description:
Enables endopeptidase activity. Involved in several processes, including nervous system development; protein processing; and response to forskolin. Located in several cellular components, including perikaryon; perinuclear region of cytoplasm; and trans-Golgi network. Used to study hyperglycemia and type 2 diabetes mellitus. Biomarker of hyperglycemia; hyperthyroidism; hypothyroidism; islet cell tumor; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in obesity and proprotein convertase 1/3 deficiency. Orthologous to human PCSK1 (proprotein convertase subtilisin/kexin type 1); PARTICIPATES IN altered energy homeostasis pathway; altered melanocortin system pathway; melanocortin system pathway; INTERACTS WITH (+)-pilocarpine; 1,2-dimethylhydrazine; 1,3-dinitrobenzene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
BDP; NEC 1; neuroendocrine convertase 1; PC1; PC3; prohormone convertase 1; prohormone convertase 3; proprotein convertase 1; Protein convertase subtilisin / kexin type I; Protein convertase subtilisin / kexin, type I
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 6,130,045 - 6,176,974 (+) NCBI GRCr8 mRatBN7.2 2 4,395,543 - 4,442,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 4,395,543 - 4,442,434 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 11,498,001 - 11,544,940 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 9,597,257 - 9,644,196 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 4,240,758 - 4,287,694 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 91,450,162 - 91,497,091 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 91,450,162 - 91,497,091 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 2,274,882 - 2,309,886 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 1,923,309 - 1,970,238 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 1,937,434 - 1,981,975 (+) NCBI Celera 2 885,989 - 932,918 (+) NCBI Celera Cytogenetic Map 2 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pcsk1 Rat Dehydration IEP 2308904 associated with Protein-Energy Malnutrition; protein:increased expression:pituitary (rat) RGD Pcsk1 Rat Dwarfism ISO RGD:734346 737721 RGD Pcsk1 Rat Endotoxemia IEP 6483567 RGD Pcsk1 Rat Experimental Diabetes Mellitus IEP 2308905 mRNA, protein:increased expression:spleen, spleen white pulp (rat) RGD Pcsk1 Rat Experimental Diabetes Mellitus ISO RGD:734346 2308931 protein:increased expression:pancreatic alpha cell (mouse) RGD Pcsk1 Rat Experimental Diabetes Mellitus ISO RGD:734346 2308905 mRNA, protein:increased expression:spleen (mouse) RGD Pcsk1 Rat Experimental Seizures IEP 2308918 mRNA:increased expression:dentate gyrus granule cell layer (rat) RGD Pcsk1 Rat glucose intolerance ISO RGD:734346 2308929 associated with Hyperinsulinemia, Aniridia; mRNA, protein:decreased expression:pancreatic islet (mouse) RGD Pcsk1 Rat hyperglycemia IEP 2308919 associated with Diabetes Mellitus, Experimental; protein, mRNA:altered expression:pancreatic islet (rat) RGD Pcsk1 Rat hyperglycemia IDA 2308899 associated with Diabetes Mellitus, Experimental; protein:increased expression:hepatocyte (rat) RGD Pcsk1 Rat hyperthyroidism IEP 2308889 mRNA:decreased expression:hypothalamus, hippocampus, cortex (rat) RGD Pcsk1 Rat hyperthyroidism IEP 1601276 protein:decreased expression:paraventricular nucleus, median eminence (rat) RGD Pcsk1 Rat hypogonadism ISO RGD:734345 1357926 RGD Pcsk1 Rat hypothyroidism IEP 2308889 mRNA:increased expression:hypothalamus, hippocampus, cortex (rat) RGD Pcsk1 Rat hypothyroidism IEP 1600414 protein:increased expression:paraventricular nucleus, lateral hypothalamic nucleus (rat) RGD Pcsk1 Rat Inflammation IEP 2308900 protein:increased expression:paw, leukocyte (rat) RGD Pcsk1 Rat Inflammation IEP 407580520 mRNA:increased expression:lymph node RGD Pcsk1 Rat islet cell tumor IEP 2308920 protein:increased expression:insulinoma (rat) RGD Pcsk1 Rat morbid obesity ISO RGD:734345 1357926 RGD Pcsk1 Rat obesity ISO RGD:734345 1601274 DNA:missense mutation:cds: p.G483R (human) RGD Pcsk1 Rat obesity ISO RGD:734345 1357925 RGD Pcsk1 Rat type 1 diabetes mellitus ISO RGD:734346 2308934 protein:increased expression:pancreatic islet (mouse) RGD Pcsk1 Rat type 2 diabetes mellitus no_association ISO RGD:734345 2308935 DNA:missense mutations:cds:p.R53Q, p.Q638E (human) RGD Pcsk1 Rat type 2 diabetes mellitus IDA 2308898 RGD Pcsk1 Rat type 2 diabetes mellitus IEP 2298715 protein:altered expression:pancreatic islet (rat) RGD Pcsk1 Rat type 2 diabetes mellitus ISO RGD:734346 2308932 protein:decreased expression:pancreatic islet (mouse) RGD Pcsk1 Rat type 2 diabetes mellitus ISO RGD:734346 2308930 protein:increased expression:pancreatic alpha cell (mouse) RGD
Pcsk1 Rat familial adenomatous polyposis 1 ISO RGD:734345 8554872 ClinVar Annotator: match by term: Familial adenomatous polyposis 1 ClinVar PMID:17963004|PMID:18487285|PMID:19279422|PMID:19409520|PMID:20685668|PMID:21643010|PMID:28492532 Pcsk1 Rat genetic disease ISO RGD:734345 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Pcsk1 Rat Hereditary Neoplastic Syndromes ISO RGD:734345 8554872 ClinVar Annotator: match by term: Hereditary Cancer Syndrome ClinVar PMID:18487285|PMID:19279422|PMID:21643010|PMID:28492532 Pcsk1 Rat Hereditary Neoplastic Syndromes ISO RGD:734345 8554872 ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome ClinVar PMID:17963004|PMID:18487285|PMID:19279422|PMID:19409520|PMID:20685668|PMID:21643010|PMID:28492532 Pcsk1 Rat Neurodevelopmental Disorders ISO RGD:734345 8554872 ClinVar Annotator: match by term: Neurodevelopmental abnormality ClinVar PMID:25741868 Pcsk1 Rat obesity ISO RGD:734345 8554872 ClinVar Annotator: match by term: Monogenic Non-Syndromic Obesity | ClinVar Annotator: match by term: Monogenic more ... ClinVar PMID:25741868|PMID:28492532 Pcsk1 Rat proprotein convertase 1/3 deficiency ISO RGD:734345 8554872 ClinVar Annotator: match by term: OBESITY AND ENDOCRINOPATHY DUE TO IMPAIRED PROCESSING OF PROHORMONES | more ... ClinVar PMID:14617756|PMID:16199547|PMID:17595246|PMID:22210313|PMID:23383060|PMID:23562752|PMID:23800642|PMID:24041679|PMID:24135795|PMID:24280991|PMID:24932808|PMID:25272002|PMID:25741868|PMID:26207343|PMID:26786350|PMID:27187081|PMID:27391121|PMID:28377240|PMID:28492532|PMID:30383237|PMID:35574020|PMID:9207799
Only show annotations with direct experimental evidence (0 objects hidden)
Pcsk1 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of PCSK1 mRNA CTD PMID:9015327 Pcsk1 Rat 1,2-dichloroethane decreases expression ISO RGD:734346 6480464 ethylene dichloride results in decreased expression of PCSK1 mRNA CTD PMID:28960355 Pcsk1 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of PCSK1 mRNA CTD PMID:27840820 Pcsk1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:734346 6480464 1,2-Dimethylhydrazine results in decreased expression of PCSK1 mRNA CTD PMID:22206623 Pcsk1 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of PCSK1 mRNA CTD PMID:21983209 Pcsk1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PCSK1 mRNA CTD PMID:17557909 Pcsk1 Rat 17beta-estradiol increases expression ISO RGD:734345 6480464 Estradiol results in increased expression of PCSK1 mRNA CTD PMID:25878060 Pcsk1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PCSK1 mRNA CTD PMID:26496021 Pcsk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK1 mRNA; Tetrachlorodibenzodioxin results in decreased expression of PCSK1 more ... CTD PMID:10919282|PMID:32109520 Pcsk1 Rat 3,3',5-triiodo-L-thyronine decreases expression ISO RGD:734345 6480464 Triiodothyronine results in decreased expression of PCSK1 mRNA CTD PMID:15291740 Pcsk1 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:734345 6480464 Decitabine affects the expression of PCSK1 mRNA CTD PMID:17145863 Pcsk1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PCSK1 mRNA CTD PMID:24780913 Pcsk1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PCSK1 mRNA CTD PMID:30047161 Pcsk1 Rat 8-Br-cAMP increases expression ISO RGD:734345 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PCSK1 mRNA CTD PMID:20147733|PMID:22079614 Pcsk1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PCSK1 mRNA CTD PMID:31881176 Pcsk1 Rat acetylsalicylic acid decreases expression ISO RGD:734345 6480464 Aspirin results in decreased expression of PCSK1 mRNA CTD PMID:11906190 Pcsk1 Rat aflatoxin B1 increases methylation ISO RGD:734345 6480464 Aflatoxin B1 results in increased methylation of PCSK1 gene CTD PMID:27153756 Pcsk1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PCSK1 mRNA CTD PMID:35163327 Pcsk1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PCSK1 mRNA CTD PMID:30047161 Pcsk1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PCSK1 mRNA CTD PMID:16483693 Pcsk1 Rat arsenite(3-) increases methylation ISO RGD:734345 6480464 arsenite results in increased methylation of PCSK1 promoter CTD PMID:23974009 Pcsk1 Rat arsenous acid increases expression ISO RGD:734345 6480464 Arsenic Trioxide results in increased expression of PCSK1 mRNA CTD PMID:21461292 Pcsk1 Rat benzo[a]pyrene affects methylation ISO RGD:734345 6480464 Benzo(a)pyrene affects the methylation of PCSK1 promoter CTD PMID:27901495 Pcsk1 Rat benzo[a]pyrene decreases methylation ISO RGD:734345 6480464 Benzo(a)pyrene results in decreased methylation of PCSK1 exon CTD PMID:27901495 Pcsk1 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:734346 6480464 Mustard Gas results in increased expression of PCSK1 mRNA CTD PMID:15674843 Pcsk1 Rat bisphenol A decreases expression ISO RGD:734345 6480464 bisphenol A results in decreased expression of PCSK1 mRNA CTD PMID:25878060 Pcsk1 Rat bisphenol A multiple interactions ISO RGD:734345 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PCSK1 gene CTD PMID:31601247 Pcsk1 Rat bisphenol A increases expression ISO RGD:734346 6480464 bisphenol A results in increased expression of PCSK1 mRNA CTD PMID:30951980 Pcsk1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PCSK1 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Pcsk1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PCSK1 mRNA CTD PMID:26496021 Pcsk1 Rat bisphenol F increases expression ISO RGD:734346 6480464 bisphenol F results in increased expression of PCSK1 mRNA CTD PMID:30951980 Pcsk1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of PCSK1 mRNA CTD PMID:32479839 Pcsk1 Rat CGP 52608 multiple interactions ISO RGD:734345 6480464 CGP 52608 promotes the reaction [RORA protein binds to PCSK1 gene] CTD PMID:28238834 Pcsk1 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of PCSK1 mRNA CTD PMID:23125180 Pcsk1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PCSK1 mRNA CTD PMID:22023808 Pcsk1 Rat clothianidin decreases expression ISO RGD:734345 6480464 clothianidin results in decreased expression of PCSK1 mRNA CTD PMID:31626844 Pcsk1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of PCSK1 mRNA CTD PMID:27899881 Pcsk1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PCSK1 mRNA CTD PMID:26577399 Pcsk1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PCSK1 mRNA CTD PMID:27523638 Pcsk1 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of PCSK1 mRNA CTD PMID:23640034 Pcsk1 Rat diarsenic trioxide increases expression ISO RGD:734345 6480464 Arsenic Trioxide results in increased expression of PCSK1 mRNA CTD PMID:21461292 Pcsk1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Pcsk1 Rat dorsomorphin multiple interactions ISO RGD:734345 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk1 Rat doxorubicin decreases expression ISO RGD:734345 6480464 Doxorubicin results in decreased expression of PCSK1 mRNA CTD PMID:29803840 Pcsk1 Rat epoxiconazole increases expression ISO RGD:734346 6480464 epoxiconazole results in increased expression of PCSK1 mRNA CTD PMID:35436446 Pcsk1 Rat ethanol affects expression ISO RGD:734346 6480464 Ethanol affects the expression of PCSK1 mRNA CTD PMID:30319688 Pcsk1 Rat folic acid decreases expression ISO RGD:734346 6480464 Folic Acid results in decreased expression of PCSK1 mRNA CTD PMID:25629700 Pcsk1 Rat fulvestrant multiple interactions ISO RGD:734345 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PCSK1 gene CTD PMID:31601247 Pcsk1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of PCSK1 mRNA CTD PMID:26194646 Pcsk1 Rat gatifloxacin increases expression ISO RGD:734345 6480464 gatifloxacin results in increased expression of PCSK1 mRNA CTD PMID:23200776 Pcsk1 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of PCSK1 mRNA CTD PMID:24395379 Pcsk1 Rat glyphosate decreases expression ISO RGD:734346 6480464 Glyphosate results in decreased expression of PCSK1 mRNA CTD PMID:35489704 Pcsk1 Rat Licochalcone B decreases expression ISO RGD:734345 6480464 licochalcone B results in decreased expression of PCSK1 mRNA CTD PMID:33647349 Pcsk1 Rat lipopolysaccharide multiple interactions ISO RGD:734345 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PCSK1 mRNA CTD PMID:35811015 Pcsk1 Rat mercury dibromide decreases expression ISO RGD:734345 6480464 mercuric bromide results in decreased expression of PCSK1 mRNA CTD PMID:26272509 Pcsk1 Rat mercury dibromide multiple interactions ISO RGD:734345 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of PCSK1 mRNA CTD PMID:19564919 Pcsk1 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of PCSK1 mRNA CTD PMID:19564919 Pcsk1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PCSK1 mRNA CTD PMID:30047161 Pcsk1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PCSK1 gene CTD PMID:35440735 Pcsk1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PCSK1 gene CTD PMID:33148267 Pcsk1 Rat nickel atom increases expression ISO RGD:734345 6480464 Nickel results in increased expression of PCSK1 mRNA CTD PMID:24768652|PMID:25583101 Pcsk1 Rat p-chloromercuribenzoic acid decreases expression ISO RGD:734345 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PCSK1 mRNA CTD PMID:26272509 Pcsk1 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:734345 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PCSK1 mRNA CTD PMID:19162173 Pcsk1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PCSK1 mRNA CTD PMID:35163327 Pcsk1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PCSK1 gene CTD PMID:33148267 Pcsk1 Rat phenylmercury acetate decreases expression ISO RGD:734345 6480464 Phenylmercuric Acetate results in decreased expression of PCSK1 mRNA CTD PMID:26272509 Pcsk1 Rat phenylmercury acetate multiple interactions ISO RGD:734345 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk1 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of PCSK1 mRNA CTD PMID:25905778 Pcsk1 Rat rotenone increases expression ISO RGD:734345 6480464 Rotenone results in increased expression of PCSK1 mRNA CTD PMID:29955902 Pcsk1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PCSK1 protein CTD PMID:35544339 Pcsk1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:734345 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of PCSK1 mRNA CTD PMID:35811015 Pcsk1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:734345 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PCSK1 mRNA CTD PMID:35811015 Pcsk1 Rat SB 431542 multiple interactions ISO RGD:734345 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk1 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of PCSK1 mRNA CTD PMID:19564919 Pcsk1 Rat SCH 23390 affects expression EXP 6480464 SCH 23390 affects the expression of PCSK1 mRNA CTD PMID:19564919 Pcsk1 Rat silicon dioxide decreases expression ISO RGD:734345 6480464 Silicon Dioxide analog results in decreased expression of PCSK1 mRNA CTD PMID:25895662 Pcsk1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PCSK1 mRNA CTD PMID:19281266 Pcsk1 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of PCSK1 mRNA CTD PMID:25905778 Pcsk1 Rat sulforaphane decreases expression ISO RGD:734345 6480464 sulforaphane results in decreased expression of PCSK1 mRNA CTD PMID:31838189 Pcsk1 Rat temozolomide decreases expression ISO RGD:734345 6480464 Temozolomide results in decreased expression of PCSK1 mRNA CTD PMID:31758290 Pcsk1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PCSK1 mRNA CTD PMID:34492290 Pcsk1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PCSK1 gene CTD PMID:27618143 Pcsk1 Rat trichostatin A increases expression ISO RGD:734345 6480464 trichostatin A results in increased expression of PCSK1 mRNA CTD PMID:24935251|PMID:26705709 Pcsk1 Rat valproic acid affects expression ISO RGD:734345 6480464 Valproic Acid affects the expression of PCSK1 mRNA CTD PMID:25979313 Pcsk1 Rat valproic acid increases expression ISO RGD:734345 6480464 Valproic Acid results in increased expression of PCSK1 mRNA CTD PMID:23179753|PMID:24935251|PMID:27188386|PMID:28001369
(+)-pilocarpine (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',5-triiodo-L-thyronine (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetamide (EXP) acetylsalicylic acid (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) CGP 52608 (ISO) chloroprene (EXP) cisplatin (EXP) clothianidin (ISO) cocaine (EXP) Cuprizon (EXP) decabromodiphenyl ether (EXP) diarsenic trioxide (ISO) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) fulvestrant (ISO) furan (EXP) gatifloxacin (ISO) glycidol (EXP) glyphosate (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methamphetamine (EXP) methimazole (EXP) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) nickel atom (ISO) p-chloromercuribenzoic acid (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenylmercury acetate (ISO) resveratrol (EXP) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) SCH 23390 (EXP) silicon dioxide (ISO) Soman (EXP) streptozocin (EXP) sulforaphane (ISO) temozolomide (ISO) thioacetamide (EXP) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO)
1.
Increased secretory demand rather than a defect in the proinsulin conversion mechanism causes hyperproinsulinemia in a glucose-infusion rat model of non-insulin-dependent diabetes mellitus.
Alarcon C, etal., J Clin Invest. 1995 Mar;95(3):1032-9.
2.
Colocalization of chaperone Cpn60, proinsulin and convertase PC1 within immature secretory granules of insulin-secreting cells suggests a role for Cpn60 in insulin processing.
Arias AE, etal., J Cell Sci. 2000 Jun;113 ( Pt 11):2075-83.
3.
Regulation of the biosynthesis and processing of chromogranins in organotypic slices: influence of depolarization, forskolin and differentiating factors.
Bauer R, etal., Eur J Neurosci. 2000 Aug;12(8):2746-56.
4.
Immunohistochemical expression and colocalization of somatostatin, carboxypeptidase-E and prohormone convertases 1 and 2 in rat brain.
Billova S, etal., Neuroscience. 2007 Jun 29;147(2):403-18. Epub 2007 Jun 1.
5.
Prohormone-converting enzymes: regulation and evaluation of function using antisense RNA.
Bloomquist BT, etal., Mol Endocrinol 1991 Dec;5(12):2014-24.
6.
Altered proinsulin conversion in rat pancreatic islets exposed long-term to various glucose concentrations or interleukin-1beta.
Borjesson A and Carlsson C, J Endocrinol. 2007 Feb;192(2):381-7.
7.
Distribution and colocalization of cholecystokinin with the prohormone convertase enzymes PC1, PC2, and PC5 in rat brain.
Cain BM, etal., J Comp Neurol 2003 Dec 15;467(3):307-25.
8.
Dietary sodium modulates mRNA abundance of enzymes involved in pituitary processing of proopiomelanocortin.
Chandramohan G, etal., Pituitary. 2001 Sep;4(4):231-7.
9.
Docosahexaenoic acid significantly stimulates immediate early response genes and neurite outgrowth.
Dagai L, etal., Neurochem Res. 2009 May;34(5):867-75. Epub 2008 Sep 10.
10.
Intraorganellar calcium and pH control proinsulin cleavage in the pancreatic beta cell via two distinct site-specific endopeptidases.
Davidson HW, etal., Nature. 1988 May 5;333(6168):93-6. doi: 10.1038/333093a0.
11.
Gene expression of proprotein convertases in individual rat anterior pituitary cells and their regulation in corticotrophs mediated by glucocorticoids.
Dong W and Day R, Endocrinology 2002 Jan;143(1):254-62.
12.
Cellular colocalization and coregulation between hypothalamic pro-TRH and prohormone convertases in hypothyroidism.
Espinosa VP, etal., Am J Physiol Endocrinol Metab. 2007 Jan;292(1):E175-86. Epub 2006 Aug 22.
13.
Differential regulation of prohormone convertase 1/3, prohormone convertase 2 and phosphorylated cyclic-AMP-response element binding protein by short-term and long-term morphine treatment: implications for understanding the "switch" to opiate addiction.
Espinosa VP, etal., Neuroscience. 2008 Oct 15;156(3):788-99. Epub 2008 Aug 9.
14.
Adult rat liver cells transdifferentiated with lentiviral IPF1 vectors reverse diabetes in mice: an ex vivo gene therapy approach.
Fodor A, etal., Diabetologia. 2007 Jan;50(1):121-30. Epub 2006 Nov 28.
15.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
16.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
17.
Proinsulin processing in the diabetic Goto-Kakizaki rat.
Guest PC, etal., J Endocrinol. 2002 Dec;175(3):637-47.
18.
Gene expression alterations of neurotrophins, their receptors and prohormone convertases in a rat model of spinal cord contusion.
Hajebrahimi Z, etal., Neurosci Lett. 2008 Aug 29;441(3):261-6. Epub 2008 Jun 21.
19.
Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats.
Hakes DJ, etal., Endocrinology 1991 Dec;129(6):3053-63.
20.
Obesity and impaired prohormone processing associated with mutations in the human prohormone convertase 1 gene.
Jackson RS, etal., Nat Genet. 1997 Jul;16(3):303-6.
21.
Gene expression patterns of pro-opiomelanocortin-processing enzymes PC1 and PC2 during postnatal development of rat corticotrophs.
Kato H, etal., J Histochem Cytochem. 2004 Jul;52(7):943-57.
22.
Lipopolysaccharide mediated regulation of neuroendocrine associated proprotein convertases and neuropeptide precursor processing in the rat spleen.
Lansac G, etal., J Neuroimmunol. 2006 Feb;171(1-2):57-71. Epub 2005 Dec 5.
23.
Developmental expression of proprotein convertase 1/3 in the rat.
Lee YC, etal., Mol Cell Endocrinol. 1999 Sep 10;155(1-2):27-35.
24.
Prohormone convertases 1 and 2 process ProPACAP and generate matured, bioactive PACAP38 and PACAP27 in transfected rat pituitary GH4C1 cells.
Li M, etal., Neuroendocrinology. 1999 Mar;69(3):217-26.
25.
Regulation of prohormone convertase 1 (PC1) by gp130-related cytokines.
Li QL, etal., Mol Cell Endocrinol. 1999 Dec 20;158(1-2):143-52.
26.
The identification of potential factors associated with the development of type 2 diabetes: a quantitative proteomics approach.
Lu H, etal., Mol Cell Proteomics. 2008 Aug;7(8):1434-51. Epub 2008 Apr 30.
27.
B Lymphocytes Express Pomc mRNA, Processing Enzymes and β-Endorphin in Painful Inflammation.
Maddila SC, etal., J Neuroimmune Pharmacol. 2017 Mar;12(1):180-186. doi: 10.1007/s11481-016-9715-4. Epub 2016 Nov 11.
28.
Electron microscopic immunocytochemical evidence for the involvement of the convertases PC1 and PC2 in the processing of proinsulin in pancreatic beta-cells.
Malide D, etal., J Histochem Cytochem. 1995 Jan;43(1):11-9.
29.
Developmental expression of the prohormone convertases PC1 and PC2 in mouse pancreatic islets.
Marcinkiewicz M, etal., Endocrinology. 1994 Oct;135(4):1651-60.
30.
Pilocarpine-induced seizures are accompanied by a transient elevation in the messenger RNA expression of the prohormone convertase PC1 in rat hippocampus: comparison with nerve growth factor and brain-derived neurotrophic factor expression.
Marcinkiewicz M, etal., Neuroscience. 1997 Jan;76(2):425-39.
31.
Adenovirally encoded prohormone convertase-1 functions in atrial myocyte large dense core vesicles.
Marx R and Mains RE, Endocrinology. 1997 Dec;138(12):5108-18.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
Subcellular pathways of beta-endorphin synthesis, processing, and release from immunocytes in inflammatory pain.
Mousa SA, etal., Endocrinology. 2004 Mar;145(3):1331-41. Epub 2003 Nov 20.
34.
Immunocytochemical localization of the prohormone convertases PC1 and PC2 in rat prolactin cells.
Muller L, etal., J Histochem Cytochem. 1998 Jan;46(1):101-8.
35.
Up-regulation of splenic prohormone convertases PC1 and PC2 in diabetic rats.
Nakashima M, etal., Regul Pept. 2001 Dec 15;102(2-3):135-45.
36.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
37.
Precursor-protein convertase 1 gene expression in the mouse hypothalamus: differential regulation by ob gene mutation, energy deficit and administration of leptin, and coexpression with prepro-orexin.
Nilaweera KN, etal., Neuroscience. 2003;119(3):713-20.
38.
Regulation of prohormone convertases in hypothalamic neurons: implications for prothyrotropin-releasing hormone and proopiomelanocortin.
Nillni EA Endocrinology. 2007 Sep;148(9):4191-200. Epub 2007 Jun 21.
39.
Extracellular matrix proteins increase the expression of pro-TRH and pro-protein convertase PC1 in fetal hypothalamic neurons in vitro.
Niquet J, etal., Brain Res Dev Brain Res. 2000 Mar 15;120(1):49-56.
40.
Human prohormone convertase 3 gene: exon-intron organization and molecular scanning for mutations in Japanese subjects with NIDDM.
Ohagi S, etal., Diabetes. 1996 Jul;45(7):897-901.
41.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
42.
How the hindgut can cure type 2 diabetes. Ileal transposition improves glucose metabolism and beta-cell function in Goto-kakizaki rats through an enhanced Proglucagon gene expression and L-cell number.
Patriti A, etal., Surgery. 2007 Jul;142(1):74-85.
43.
Thyroid hormones selectively regulate the posttranslational processing of prothyrotropin-releasing hormone in the paraventricular nucleus of the hypothalamus.
Perello M, etal., Endocrinology. 2006 Jun;147(6):2705-16. Epub 2006 Feb 23.
44.
Pro-opiomelanocortin processing in the hypothalamus: impact on melanocortin signalling and obesity.
Pritchard LE, etal., J Endocrinol 2002 Mar;172(3):411-21.
45.
GOA pipeline
RGD automated data pipeline
46.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
47.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
48.
Preferential cleavage of des-31,32-proinsulin over intact proinsulin by the insulin secretory granule type II endopeptidase. Implication of a favored route for prohormone processing.
Rhodes CJ, etal., J Biol Chem. 1992 Nov 15;267(32):22719-27.
49.
Altered control of the hypothalamo-pituitary-adrenal axis in adult male rats exposed perinatally to food deprivation and/or dehydration.
Sebaai N, etal., Neuroendocrinology. 2002 Oct;76(4):243-53.
50.
The critical role of the melanocortin system in the control of energy balance.
Seeley RJ, etal., Annu Rev Nutr 2004;24:133-49.
51.
Thyroid hormone regulation of prohormone convertase 1 (PC1): regional expression in rat brain and in vitro characterization of negative thyroid hormone response elements.
Shen X, etal., J Mol Endocrinol. 2004 Aug;33(1):21-33.
52.
Mutational analysis of predicted interactions between the catalytic and P domains of prohormone convertase 3 (PC3/PC1).
Ueda K, etal., Proc Natl Acad Sci U S A 2003 May 13;100(10):5622-7.
53.
MAFA controls genes implicated in insulin biosynthesis and secretion.
Wang H, etal., Diabetologia. 2007 Feb;50(2):348-58. Epub 2006 Dec 6.
54.
Paired box 6 (PAX6) regulates glucose metabolism via proinsulin processing mediated by prohormone convertase 1/3 (PC1/3).
Wen JH, etal., Diabetologia. 2009 Mar;52(3):504-13. Epub 2008 Nov 26.
55.
A switch from prohormone convertase (PC)-2 to PC1/3 expression in transplanted alpha-cells is accompanied by differential processing of proglucagon and improved glucose homeostasis in mice.
Wideman RD, etal., Diabetes. 2007 Nov;56(11):2744-52. Epub 2007 Aug 13.
56.
Transplantation of PC1/3-Expressing alpha-cells improves glucose handling and cold tolerance in leptin-resistant mice.
Wideman RD, etal., Mol Ther. 2009 Jan;17(1):191-8. Epub 2008 Oct 21.
57.
Improving function and survival of pancreatic islets by endogenous production of glucagon-like peptide 1 (GLP-1).
Wideman RD, etal., Proc Natl Acad Sci U S A. 2006 Sep 5;103(36):13468-73. Epub 2006 Aug 28.
58.
Regional and cellular localization of the neuroendocrine prohormone convertases PC1 and PC2 in the rat central nervous system.
Winsky-Sommerer R, etal., J Comp Neurol. 2000 Aug 28;424(3):439-60.
59.
Regulation of pancreatic endocrine cell differentiation by sulphated proteoglycans.
Zertal-Zidani S, etal., Diabetologia. 2007 Mar;50(3):585-95. Epub 2007 Jan 13.
60.
The developmental expression in rat of proteases furin, PC1, PC2, and carboxypeptidase E: implications for early maturation of proteolytic processing capacity.
Zheng M, etal., J Neurosci. 1994 Aug;14(8):4656-73.
61.
Regulatory roles of the P domain of the subtilisin-like prohormone convertases.
Zhou A, etal., J Biol Chem. 1998 May 1;273(18):11107-14.
62.
Disruption of PC1/3 expression in mice causes dwarfism and multiple neuroendocrine peptide processing defects.
Zhu X, etal., Proc Natl Acad Sci U S A 2002 Aug 6;99(16):10293-8. Epub 2002 Jul 26.
Pcsk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 6,130,045 - 6,176,974 (+) NCBI GRCr8 mRatBN7.2 2 4,395,543 - 4,442,434 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 4,395,543 - 4,442,434 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 11,498,001 - 11,544,940 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 9,597,257 - 9,644,196 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 4,240,758 - 4,287,694 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 91,450,162 - 91,497,091 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 91,450,162 - 91,497,091 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 2,274,882 - 2,309,886 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 1,923,309 - 1,970,238 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 1,937,434 - 1,981,975 (+) NCBI Celera 2 885,989 - 932,918 (+) NCBI Celera Cytogenetic Map 2 q11 NCBI
PCSK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 96,390,333 - 96,433,248 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 96,390,333 - 96,434,143 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 95,726,037 - 95,768,952 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 95,751,875 - 95,794,708 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 95,751,874 - 95,794,708 NCBI Celera 5 91,608,060 - 91,651,008 (-) NCBI Celera Cytogenetic Map 5 q15 NCBI HuRef 5 90,916,038 - 90,958,959 (-) NCBI HuRef CHM1_1 5 95,158,671 - 95,201,600 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 96,891,318 - 96,934,221 (-) NCBI T2T-CHM13v2.0
Pcsk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 75,237,407 - 75,282,980 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 75,237,945 - 75,282,980 (+) Ensembl GRCm39 Ensembl GRCm38 13 75,089,420 - 75,134,861 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 75,089,826 - 75,134,861 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 75,227,435 - 75,269,946 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 75,555,989 - 75,598,500 (+) NCBI MGSCv36 mm8 Celera 13 77,413,324 - 77,455,835 (+) NCBI Celera Cytogenetic Map 13 C1 NCBI cM Map 13 40.63 NCBI
Pcsk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955418 16,181,771 - 16,224,603 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955418 16,181,809 - 16,224,274 (+) NCBI ChiLan1.0 ChiLan1.0
PCSK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 18,947,427 - 18,989,920 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 17,101,051 - 17,143,521 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 18,917,488 - 18,960,102 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 19,064,004 - 19,106,486 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 19,064,004 - 19,106,486 (+) Ensembl panpan1.1 panPan2
PCSK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 13,233,342 - 13,276,921 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 13,233,594 - 13,274,094 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 14,573,263 - 14,616,624 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 13,112,863 - 13,155,997 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 13,112,897 - 13,155,993 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 13,076,913 - 13,120,227 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 13,073,463 - 13,116,776 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 13,272,840 - 13,316,211 (+) NCBI UU_Cfam_GSD_1.0
Pcsk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 168,824,505 - 168,864,179 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936523 7,010,068 - 7,050,468 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936523 7,009,966 - 7,050,300 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PCSK1
PCSK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 90,246,413 - 90,289,148 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 90,248,598 - 90,289,089 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 38,898,564 - 38,941,574 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pcsk1
.
Predicted Target Of
Count of predictions: 240 Count of miRNA genes: 160 Interacting mature miRNAs: 184 Transcripts: ENSRNOT00000015185 Prediction methods: Miranda Result types: miRGate_prediction
738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat
M58589
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 4,439,925 - 4,440,044 (-) MAPPER mRatBN7.2 Rnor_6.0 2 91,452,552 - 91,452,670 NCBI Rnor6.0 Rnor_5.0 2 2,307,378 - 2,307,496 UniSTS Rnor5.0 Rnor_5.0 2 111,213,493 - 111,213,611 UniSTS Rnor5.0 RGSC_v3.4 2 1,967,730 - 1,967,848 UniSTS RGSC3.4 Celera 2 930,410 - 930,528 UniSTS Cytogenetic Map 2 q11-q12 UniSTS
AU049217
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 4,431,894 - 4,432,100 (-) MAPPER mRatBN7.2 Rnor_6.0 2 91,460,496 - 91,460,701 NCBI Rnor6.0 Rnor_5.0 2 2,299,347 - 2,299,552 UniSTS Rnor5.0 Rnor_5.0 2 111,221,437 - 111,221,642 UniSTS Rnor5.0 RGSC_v3.4 2 1,959,699 - 1,959,904 UniSTS RGSC3.4 Celera 2 922,379 - 922,584 UniSTS Cytogenetic Map 2 q11-q12 UniSTS
BE119208
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 4,439,827 - 4,439,977 (-) MAPPER mRatBN7.2 Rnor_6.0 2 91,452,619 - 91,452,768 NCBI Rnor6.0 Rnor_5.0 2 2,307,280 - 2,307,429 UniSTS Rnor5.0 Rnor_5.0 2 111,213,560 - 111,213,709 UniSTS Rnor5.0 RGSC_v3.4 2 1,967,632 - 1,967,781 UniSTS RGSC3.4 Celera 2 930,312 - 930,461 UniSTS Cytogenetic Map 2 q11-q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
3
7
111
61
60
32
22
32
6
102
51
91
10
29
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015185 ⟹ ENSRNOP00000015185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 4,395,543 - 4,442,434 (+) Ensembl Rnor_6.0 Ensembl 2 91,450,162 - 91,497,091 (-) Ensembl
RefSeq Acc Id:
NM_017091 ⟹ NP_058787
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 6,130,045 - 6,176,974 (+) NCBI mRatBN7.2 2 4,395,543 - 4,442,434 (+) NCBI Rnor_6.0 2 91,450,162 - 91,497,091 (-) NCBI Rnor_5.0 2 2,274,882 - 2,309,886 (+) NCBI RGSC_v3.4 2 1,923,309 - 1,970,238 (+) RGD Celera 2 885,989 - 932,918 (+) RGD
Sequence:
TTCTATTCTGGCTGGGAAGGCTGGGGCTCCTCTCAGCCAGGAGACTGAAGTGCTTCAGTGAGCGCTGGCTCATCGCCGCCCAGCCTCTCCCAGGGAGCCTCCTAGCTCTAGTAAAGCAACCCAGAGCC
hide sequence
RefSeq Acc Id:
NP_058787 ⟸ NM_017091
- Peptide Label:
precursor
- UniProtKB:
P28840 (UniProtKB/Swiss-Prot), A6I4E7 (UniProtKB/TrEMBL)
- Sequence:
MKQRGWTLQCTAFTLFCVWCALNSVKAKRQFVNEWAAEIHGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERRKRSVPRDSALNLFNDPMWNQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000015185 ⟸ ENSRNOT00000015185
RGD ID: 13691229 Promoter ID: EPDNEW_R1752 Type: single initiation site Name: Pcsk1_1 Description: proprotein convertase subtilisin/kexin type 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 91,497,093 - 91,497,153 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Pcsk1
Protein convertase subtilisin / kexin, type I
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in endocrine and neuroendocrine tissues
70278
gene_process
has a role in the maturation of mammalian hormones
70278
gene_process
may function in secretory pathway
70278
gene_product
752 aa protein
70278
