Symbol:
Myl3
Name:
myosin light chain 3
RGD ID:
3142
Description:
Enables cytoskeletal motor activity. Involved in cardiac muscle contraction and skeletal muscle tissue development. Part of myosin complex. Human ortholog(s) of this gene implicated in hypertrophic cardiomyopathy 8. Orthologous to human MYL3 (myosin light chain 3); PARTICIPATES IN prostaglandin I2 signaling pathway; dilated cardiomyopathy pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH (R)-noradrenaline; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93574; MLC1SB; MLClV; Mylc1v; myosin alkali light chain 1, ventricular; myosin light chain 1, slow-twitch muscle B/ventricular isoform; Myosin light chain 3 alkali cardiac ventricles; Myosin light chain 3, alkali, cardiac ventricles; myosin, light chain 3, alkali; myosin, light chain 3, alkali; ventricular, skeletal, slow; myosin, light polypeptide 3; rVMLC1; ventricular myosin light chain 1; ventricular, skeletal, slow; ventricular/slow twitch myosin alkali light chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYL3 (myosin light chain 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Myl3 (myosin, light polypeptide 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myl3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYL3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYL3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myl3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYL3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYL3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myl3 (myosin light chain 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MYL4 (myosin light chain 4) HGNC
OrthoDB
Homo sapiens (human):
CNNM1 (cyclin and CBS domain divalent metal cation transport mediator 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MYL3 (myosin light chain 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Myl3 (myosin, light polypeptide 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
myl4 (myosin, light chain 4, alkali; atrial, embryonic)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
myl13 (myosin, light chain 13)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
MLC1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Mlc-c
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mlc-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mlc-7
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
mlc-3
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
mlc-6
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
myl3
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Candidate Gene For:
Vetf5
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 119,617,077 - 119,623,215 (+) NCBI GRCr8 mRatBN7.2 8 110,738,669 - 110,744,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 110,738,661 - 110,744,816 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 116,353,285 - 116,359,407 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 114,552,491 - 114,558,613 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 112,395,292 - 112,401,414 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 119,030,852 - 119,036,996 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 119,030,875 - 119,036,996 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 118,370,030 - 118,376,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 115,140,705 - 115,146,827 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 115,160,166 - 115,166,273 (+) NCBI Celera 8 110,021,445 - 110,027,566 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Myl3 Rat (R)-noradrenaline decreases expression EXP 6480464 Norepinephrine results in decreased expression of MYL3 mRNA CTD PMID:14618266 Myl3 Rat 1,2-dichloroethane increases expression ISO Myl3 (Mus musculus) 6480464 ethylene dichloride results in increased expression of MYL3 mRNA CTD PMID:28960355 Myl3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MYL3 mRNA CTD PMID:32145629 Myl3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Myl3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYL3 mRNA CTD PMID:32109520 Myl3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Myl3 Rat 2,6-di-tert-butyl-4-methylphenol increases expression ISO Myl3 (Mus musculus) 6480464 Butylated Hydroxytoluene results in increased expression of MYL3 mRNA CTD PMID:19925653 Myl3 Rat 4,4'-sulfonyldiphenol decreases expression ISO MYL3 (Homo sapiens) 6480464 bisphenol S results in decreased expression of MYL3 mRNA CTD PMID:33476716 Myl3 Rat 4,4'-sulfonyldiphenol increases expression ISO Myl3 (Mus musculus) 6480464 bisphenol S results in increased expression of MYL3 mRNA CTD PMID:30951980 Myl3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MYL3 mRNA CTD PMID:24780913 Myl3 Rat 7H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in increased expression of MYL3 protein CTD PMID:19464573 Myl3 Rat 9H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in increased expression of MYL3 protein CTD PMID:19464573 Myl3 Rat acrolein affects metabolic processing ISO Myl3 (Mus musculus) 6480464 Acrolein affects the metabolism of MYL3 protein CTD PMID:17921335 Myl3 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of MYL3 mRNA CTD PMID:24977338 Myl3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MYL3 mRNA CTD PMID:16483693 Myl3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MYL3 mRNA CTD PMID:30779732 Myl3 Rat arsane increases expression ISO Myl3 (Mus musculus) 6480464 Arsenic results in increased expression of MYL3 protein CTD PMID:22552367 Myl3 Rat arsenic atom increases expression ISO Myl3 (Mus musculus) 6480464 Arsenic results in increased expression of MYL3 protein CTD PMID:22552367 Myl3 Rat Azoxymethane multiple interactions ISO Myl3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL3 mRNA CTD PMID:29950665 Myl3 Rat benzo[a]pyrene decreases expression ISO Myl3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MYL3 mRNA CTD PMID:22228805 Myl3 Rat benzo[a]pyrene decreases methylation ISO MYL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MYL3 3' UTR and Benzo(a)pyrene results in decreased methylation of MYL3 promoter CTD PMID:27901495 Myl3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Myl3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MYL3 mRNA CTD PMID:28085963 Myl3 Rat bisphenol A decreases expression ISO MYL3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MYL3 mRNA CTD PMID:33476716 Myl3 Rat bisphenol A increases expression ISO MYL3 (Homo sapiens) 6480464 bisphenol A results in increased expression of MYL3 mRNA and bisphenol A results in increased expression of MYL3 protein CTD PMID:32028606 and PMID:37567409 Myl3 Rat bisphenol A decreases methylation ISO MYL3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MYL3 gene CTD PMID:31601247 Myl3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MYL3 mRNA CTD PMID:32145629 Myl3 Rat bisphenol A increases expression ISO Myl3 (Mus musculus) 6480464 bisphenol A results in increased expression of MYL3 mRNA CTD PMID:30951980 Myl3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MYL3 gene CTD PMID:28505145 Myl3 Rat bisphenol A increases methylation ISO Myl3 (Mus musculus) 6480464 bisphenol A results in increased methylation of MYL3 promoter CTD PMID:27312807 Myl3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYL3 mRNA CTD PMID:25181051 Myl3 Rat bisphenol F increases expression ISO Myl3 (Mus musculus) 6480464 bisphenol F results in increased expression of MYL3 mRNA CTD PMID:30951980 Myl3 Rat bisphenol F multiple interactions ISO MYL3 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYL3 gene CTD PMID:31601247 Myl3 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MYL3 promoter CTD PMID:22457795 Myl3 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of MYL3 mRNA CTD PMID:15913539 Myl3 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of MYL3 mRNA CTD PMID:15913539 Myl3 Rat cantharidin decreases expression ISO Myl3 (Mus musculus) 6480464 Cantharidin results in decreased expression of MYL3 mRNA CTD PMID:36907384 Myl3 Rat carbon nanotube affects expression ISO Myl3 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of MYL3 mRNA CTD PMID:25554681 Myl3 Rat carbon nanotube increases expression ISO Myl3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MYL3 mRNA CTD PMID:25620056 Myl3 Rat carbon nanotube decreases expression ISO Myl3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Myl3 Rat chromium(6+) increases expression ISO Myl3 (Mus musculus) 6480464 chromium hexavalent ion results in increased expression of MYL3 protein CTD PMID:22552367 Myl3 Rat ciguatoxin CTX1B affects expression ISO Myl3 (Mus musculus) 6480464 Ciguatoxins affects the expression of MYL3 mRNA CTD PMID:18353800 Myl3 Rat dextran sulfate multiple interactions ISO Myl3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL3 mRNA CTD PMID:29950665 Myl3 Rat dioxygen multiple interactions ISO Myl3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MYL3 mRNA CTD PMID:30529165 Myl3 Rat disodium selenite decreases expression ISO MYL3 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of MYL3 mRNA CTD PMID:18175754 Myl3 Rat doxorubicin increases expression ISO Myl3 (Mus musculus) 6480464 Doxorubicin results in increased expression of MYL3 protein CTD PMID:21251210 Myl3 Rat doxorubicin affects expression ISO MYL3 (Homo sapiens) 6480464 Doxorubicin affects the expression of MYL3 mRNA and Doxorubicin affects the expression of MYL3 protein CTD PMID:29385562 and PMID:29803840 Myl3 Rat doxorubicin decreases expression ISO MYL3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MYL3 mRNA CTD PMID:28940058 Myl3 Rat doxorubicin multiple interactions ISO Myl3 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of MYL3 protein] CTD PMID:21251210 Myl3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of MYL3 mRNA and Ethanol results in decreased expression of MYL3 protein CTD PMID:17920746 and PMID:24646710 Myl3 Rat etoposide decreases expression ISO MYL3 (Homo sapiens) 6480464 Etoposide results in decreased expression of MYL3 mRNA CTD PMID:29397400 Myl3 Rat fulvestrant multiple interactions ISO MYL3 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYL3 gene CTD PMID:31601247 Myl3 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of MYL3 mRNA CTD PMID:38314887 Myl3 Rat graphite increases expression ISO Myl3 (Mus musculus) 6480464 Graphite results in increased expression of MYL3 mRNA CTD PMID:27440207 Myl3 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of MYL3 protein CTD PMID:24286936 Myl3 Rat lead diacetate affects expression ISO Myl3 (Mus musculus) 6480464 lead acetate affects the expression of MYL3 mRNA CTD PMID:22609695 Myl3 Rat ozone decreases expression ISO Myl3 (Mus musculus) 6480464 Ozone results in decreased expression of MYL3 mRNA CTD PMID:12763052 Myl3 Rat ozone multiple interactions ISO Myl3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MYL3 mRNA CTD PMID:34911549 Myl3 Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of MYL3 protein CTD PMID:33146391 Myl3 Rat sodium arsenite increases expression ISO MYL3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MYL3 mRNA CTD PMID:35954277 Myl3 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of MYL3 protein CTD PMID:29653260 Myl3 Rat sodium nitrate multiple interactions ISO Myl3 (Mus musculus) 6480464 sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of MYL3 protein] CTD PMID:21251210 Myl3 Rat sulforaphane increases expression ISO Myl3 (Mus musculus) 6480464 sulforaphane results in increased expression of MYL3 mRNA CTD PMID:30529165 Myl3 Rat sunitinib decreases expression ISO MYL3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MYL3 mRNA CTD PMID:31533062 Myl3 Rat thalidomide affects expression ISO Myl3 (Mus musculus) 6480464 Thalidomide affects the expression of MYL3 mRNA CTD PMID:26006729 Myl3 Rat thalidomide decreases expression ISO Myl3 (Mus musculus) 6480464 Thalidomide results in decreased expression of MYL3 mRNA CTD PMID:26217789 Myl3 Rat titanium dioxide decreases expression ISO Myl3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of MYL3 mRNA CTD PMID:23557971 Myl3 Rat titanium dioxide multiple interactions ISO Myl3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MYL3 mRNA CTD PMID:29950665 Myl3 Rat triclosan decreases expression ISO MYL3 (Homo sapiens) 6480464 Triclosan results in decreased expression of MYL3 mRNA CTD PMID:30510588 Myl3 Rat triticonazole increases expression EXP 6480464 triticonazole results in increased expression of MYL3 mRNA CTD PMID:36084822 Myl3 Rat udenafil multiple interactions EXP 6480464 udenafil inhibits the reaction [Cholesterol and Dietary results in increased expression of MYL3 mRNA] CTD PMID:17137605 Myl3 Rat valproic acid increases methylation ISO MYL3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MYL3 gene CTD PMID:29154799 Myl3 Rat valproic acid affects expression ISO MYL3 (Homo sapiens) 6480464 Valproic Acid affects the expression of MYL3 mRNA CTD PMID:25979313 Myl3 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of MYL3 mRNA CTD PMID:19111725 Myl3 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of MYL3 mRNA CTD PMID:19111725 Myl3 Rat zoledronic acid decreases expression ISO MYL3 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of MYL3 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(R)-noradrenaline (EXP) 1,2-dichloroethane (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-di-tert-butyl-4-methylphenol (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7H-xanthine (EXP) 9H-xanthine (EXP) acrolein (ISO) all-trans-retinoic acid (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP) calcium atom (EXP) calcium(0) (EXP) cantharidin (ISO) carbon nanotube (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) dextran sulfate (ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) ethanol (EXP) etoposide (ISO) fulvestrant (ISO) glyphosate (EXP) graphite (ISO) isoprenaline (EXP) lead diacetate (ISO) ozone (EXP,ISO) sodium arsenite (ISO) sodium fluoride (EXP) sodium nitrate (ISO) sulforaphane (ISO) sunitinib (ISO) thalidomide (ISO) titanium dioxide (ISO) triclosan (ISO) triticonazole (EXP) udenafil (EXP) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (ISO)
1.
Myosin light chain mutations in familial hypertrophic cardiomyopathy: phenotypic presentation and frequency in Danish and South African populations.
Andersen PS, etal., J Med Genet. 2001 Dec;38(12):E43.
2.
Differential synthesis by cultured atrial and ventricular rat cardiac myocytes of myosin light chain isoforms.
Brand T, etal., FEBS Lett. 1991 Jun 3;283(2):289-90.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Nadrin, a novel neuron-specific GTPase-activating protein involved in regulated exocytosis.
Harada A, etal., J Biol Chem 2000 Nov 24;275(47):36885-91.
6.
Ventricular myosin light chain 1 is developmentally regulated and does not change in hypertension.
McNally EM, etal., Nucleic Acids Res 1989 Apr 11;17(7):2753-67.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Myosin light chain isoforms modify force-generating ability of cardiac myosin by changing the kinetics of actin-myosin interaction.
Yamashita H, etal., Cardiovasc Res. 2003 Dec 1;60(3):580-8.
Myl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 119,617,077 - 119,623,215 (+) NCBI GRCr8 mRatBN7.2 8 110,738,669 - 110,744,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 110,738,661 - 110,744,816 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 116,353,285 - 116,359,407 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 114,552,491 - 114,558,613 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 112,395,292 - 112,401,414 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 119,030,852 - 119,036,996 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 119,030,875 - 119,036,996 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 118,370,030 - 118,376,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 115,140,705 - 115,146,827 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 115,160,166 - 115,166,273 (+) NCBI Celera 8 110,021,445 - 110,027,566 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
MYL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 46,857,872 - 46,882,182 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 46,835,110 - 46,882,178 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 46,899,362 - 46,923,672 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 46,874,361 - 46,879,977 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 46,874,370 - 46,879,935 NCBI Celera 3 46,837,863 - 46,843,479 (-) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 46,942,461 - 46,948,077 (-) NCBI HuRef CHM1_1 3 46,849,457 - 46,855,073 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 46,874,270 - 46,898,580 (-) NCBI T2T-CHM13v2.0
Myl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 110,592,746 - 110,598,870 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 110,570,929 - 110,598,866 (+) Ensembl GRCm39 Ensembl GRCm38 9 110,763,678 - 110,769,802 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 110,741,861 - 110,769,798 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 110,666,185 - 110,672,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 110,608,497 - 110,614,610 (+) NCBI MGSCv36 mm8 Celera 9 110,493,398 - 110,499,489 (+) NCBI Celera Cytogenetic Map 9 F2 NCBI cM Map 9 60.69 NCBI
Myl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 25,305,759 - 25,312,271 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 25,308,513 - 25,311,959 (+) NCBI ChiLan1.0 ChiLan1.0
MYL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 46,814,351 - 46,855,308 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 46,816,862 - 46,860,077 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 46,758,058 - 46,782,425 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 47,859,467 - 47,865,084 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 47,859,467 - 47,865,084 (-) Ensembl panpan1.1 panPan2
MYL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 41,941,617 - 41,947,085 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 41,933,105 - 42,073,779 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 41,857,795 - 41,863,262 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 42,424,129 - 42,429,604 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 42,423,791 - 42,429,606 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 41,665,759 - 41,671,226 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 42,066,707 - 42,072,174 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 42,347,703 - 42,353,170 (+) NCBI UU_Cfam_GSD_1.0
Myl3
MYL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 29,707,371 - 29,735,586 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 29,730,271 - 29,735,616 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 32,978,399 - 32,983,747 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 8,263,536 - 8,272,229 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 8,261,206 - 8,269,185 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 158,859,015 - 158,883,595 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myl3
.
Predicted Target Of
Count of predictions: 35 Count of miRNA genes: 33 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000028458 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Wox8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 110,738,340 - 110,738,468 (+) MAPPER mRatBN7.2 Rnor_6.0 8 119,030,521 - 119,030,650 NCBI Rnor6.0 Rnor_5.0 8 118,369,739 - 118,369,868 UniSTS Rnor5.0 RGSC_v3.4 8 115,140,350 - 115,140,480 RGD RGSC3.4 RGSC_v3.4 8 115,140,351 - 115,140,480 UniSTS RGSC3.4 Celera 8 110,021,091 - 110,021,220 UniSTS Cytogenetic Map 8 q32 UniSTS
D8Wox9
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 119,616,739 - 119,616,951 (+) Marker Load Pipeline mRatBN7.2 8 110,738,340 - 110,738,550 (+) MAPPER mRatBN7.2 Rnor_6.0 8 119,030,521 - 119,030,732 NCBI Rnor6.0 Rnor_5.0 8 118,369,739 - 118,369,950 UniSTS Rnor5.0 RGSC_v3.4 8 115,140,350 - 115,140,562 RGD RGSC3.4 RGSC_v3.4 8 115,140,351 - 115,140,562 UniSTS RGSC3.4 RGSC_v3.1 8 115,159,805 - 115,160,017 RGD Celera 8 110,021,091 - 110,021,302 UniSTS RH 3.4 Map 8 1191.3 RGD RH 3.4 Map 8 1191.3 UniSTS RH 2.0 Map 8 935.5 RGD Cytogenetic Map 8 q32 UniSTS
D8Arb21
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 110,738,338 - 110,738,575 (+) MAPPER mRatBN7.2 Rnor_6.0 8 119,030,519 - 119,030,757 NCBI Rnor6.0 Rnor_5.0 8 118,369,737 - 118,369,975 UniSTS Rnor5.0 RGSC_v3.4 8 115,140,348 - 115,140,587 RGD RGSC3.4 RGSC_v3.4 8 115,140,349 - 115,140,587 UniSTS RGSC3.4 RGSC_v3.1 8 115,159,803 - 115,160,042 RGD Celera 8 110,021,089 - 110,021,327 UniSTS Cytogenetic Map 8 q32 UniSTS
RH138771
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 119,622,593 - 119,623,037 (+) Marker Load Pipeline mRatBN7.2 8 110,744,192 - 110,744,636 (+) MAPPER mRatBN7.2 Rnor_6.0 8 119,036,375 - 119,036,818 NCBI Rnor6.0 Rnor_5.0 8 118,375,597 - 118,376,040 UniSTS Rnor5.0 RGSC_v3.4 8 115,146,206 - 115,146,649 UniSTS RGSC3.4 Celera 8 110,026,945 - 110,027,388 UniSTS Cytogenetic Map 8 q32 UniSTS
RH94602
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 119,623,011 - 119,623,192 (+) Marker Load Pipeline mRatBN7.2 8 110,744,610 - 110,744,791 (+) MAPPER mRatBN7.2 Rnor_6.0 8 119,036,793 - 119,036,973 NCBI Rnor6.0 Rnor_5.0 8 118,376,015 - 118,376,195 UniSTS Rnor5.0 RGSC_v3.4 8 115,146,624 - 115,146,804 UniSTS RGSC3.4 Celera 8 110,027,363 - 110,027,543 UniSTS Cytogenetic Map 8 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
5
11
49
112
84
83
53
22
53
6
205
94
92
45
56
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028458 ⟹ ENSRNOP00000028458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 110,738,661 - 110,744,815 (+) Ensembl Rnor_6.0 Ensembl 8 119,030,875 - 119,036,996 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117250 ⟹ ENSRNOP00000079091
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 110,738,661 - 110,744,816 (+) Ensembl
RefSeq Acc Id:
NM_012606 ⟹ NP_036738
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 119,617,094 - 119,623,215 (+) NCBI mRatBN7.2 8 110,738,693 - 110,744,814 (+) NCBI Rnor_6.0 8 119,030,875 - 119,036,996 (+) NCBI Rnor_5.0 8 118,370,030 - 118,376,218 (+) NCBI RGSC_v3.4 8 115,140,705 - 115,146,827 (+) RGD Celera 8 110,021,445 - 110,027,566 (+) RGD
Sequence:
CTATCTCACTCTCTTCTCTCCTTCTTCCCGCCTCTCTGTGATTACAGCTCCAATGGCCCCCAAAAAGCCAGAGCCCAAGAAGGACGATGCCAAAACCGCTGCCCCCAAAGCAGCTCCGGCCCCTGCGG
hide sequence
RefSeq Acc Id:
XM_006243917 ⟹ XP_006243979
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 119,617,077 - 119,623,204 (+) NCBI mRatBN7.2 8 110,738,675 - 110,744,814 (+) NCBI Rnor_6.0 8 119,030,852 - 119,036,987 (+) NCBI Rnor_5.0 8 118,370,030 - 118,376,218 (+) NCBI
Sequence:
CCCAGGGTGGCAGTAAGGCTCACCTATCTCACTCTCTTCTCTCCTTCTTCCCGCCTCTCTGTGA
hide sequence
RefSeq Acc Id:
NP_036738 ⟸ NM_012606
- UniProtKB:
P16409 (UniProtKB/Swiss-Prot), A6I3G7 (UniProtKB/TrEMBL), A0A8I5ZM89 (UniProtKB/TrEMBL)
- Sequence:
MAPKKPEPKKDDAKTAAPKAAPAPAAAPAAAPEPERPKEAEFDASKIKIEFTPEQIEEFKEAFQLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFETFLPMLQHISK
hide sequence
RefSeq Acc Id:
XP_006243979 ⟸ XM_006243917
- Peptide Label:
isoform X1
- UniProtKB:
P16409 (UniProtKB/Swiss-Prot), A6I3G7 (UniProtKB/TrEMBL), A0A8I5ZM89 (UniProtKB/TrEMBL)
- Sequence:
MAPKKPEPKKDDAKTAAPKAAPAPAAAPAAAPEPERPKEAEFDASKIKIEFTPEQIEEFKEAFQLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFETFLPMLQHISK
hide sequence
Ensembl Acc Id:
ENSRNOP00000028458 ⟸ ENSRNOT00000028458
Ensembl Acc Id:
ENSRNOP00000079091 ⟸ ENSRNOT00000117250
RGD ID: 13696336 Promoter ID: EPDNEW_R6860 Type: single initiation site Name: Myl3_1 Description: myosin light chain 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 119,030,866 - 119,030,926 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-11
Myl3
myosin light chain 3
Myl3
myosin, light chain 3, alkali; ventricular, skeletal, slow
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-14
Myl3
myosin, light chain 3, alkali; ventricular, skeletal, slow
Myl3
myosin, light polypeptide 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Myl3
Myosin light chain 3, alkali, cardiac ventricles
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
displays low expression during development with increased expression after birth and in adult heart
633422
