Ivd (isovaleryl-CoA dehydrogenase)

Advanced Search (OLGA)

Gene: Ivd (isovaleryl-CoA dehydrogenase) Rattus norvegicus

Analyze

Symbol:

Ivd

Name:

isovaleryl-CoA dehydrogenase

RGD ID:

2936

Description:

Enables 3-methylbutanoyl-CoA dehydrogenase activity and identical protein binding activity. Involved in L-leucine catabolic process. Located in mitochondrial matrix and mitochondrial membrane. Human ortholog(s) of this gene implicated in amino acid metabolic disorder and isovaleric acidemia. Orthologous to human IVD (isovaleryl-CoA dehydrogenase); PARTICIPATES IN 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyisobutyric aciduria pathway; 3-methylcrotonyl CoA carboxylase 1 deficiency pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

butyryl-CoA dehydrogenase; isovaleryl coenzyme A dehydrogenase; isovaleryl-CoA dehydrogenase, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IVD (isovaleryl-CoA dehydrogenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ivd (isovaleryl coenzyme A dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ivd (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IVD (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IVD (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ivd (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IVD (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IVD (isovaleryl-CoA dehydrogenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	IVD (isovaleryl-CoA dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ivd (isovaleryl coenzyme A dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ivd (isovaleryl-CoA dehydrogenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ivd-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6638	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ivd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	126,305,584 - 126,326,016 (+)	NCBI		GRCr8
mRatBN7.2	3	105,851,710 - 105,872,144 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	105,851,683 - 105,872,575 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	109,524,766 - 109,545,235 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,120,320 - 118,140,785 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	115,780,686 - 115,801,150 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	110,669,355 - 110,689,789 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	110,669,312 - 110,690,173 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,207,292 - 117,227,726 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	105,374,429 - 105,394,861 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,270,846 - 105,291,661 (+)	NCBI
Celera	3	104,765,745 - 104,785,979 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amino acid metabolic disorder (ISO)

Bloom syndrome (ISO)

colorectal cancer (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

isovaleric acidemia (ISO)

mosaic variegated aneuploidy syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,4-dinitrotoluene (EXP)

2,5-hexanedione (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

flutamide (EXP)

formaldehyde (ISO)

fumonisin B1 (ISO)

furan (EXP)

hydrogen peroxide (ISO)

indometacin (EXP)

ivermectin (ISO)

ketoconazole (EXP)

lead diacetate (ISO)

methamphetamine (EXP)

methapyrilene (EXP,ISO)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

PhIP (EXP)

phlorizin (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

progesterone (EXP)

Propiverine (EXP)

resveratrol (ISO)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

branched-chain amino acid catabolic process (ISO)

carboxylic acid catabolic process (IEA)

fatty acid beta-oxidation using acyl-CoA dehydrogenase (IC,ISO)

L-leucine catabolic process (IBA,IDA,IEA,ISO)

L-leucine metabolic process (TAS)

Cellular Component

mitochondrial matrix (IDA)

mitochondrial membrane (IDA)

mitochondrion (IBA,ISO)

nucleoplasm (IEA,ISO)

Molecular Function

3-methylbutanoyl-CoA dehydrogenase activity (IBA,IDA,ISO)

acyl-CoA dehydrogenase activity (IEA)

flavin adenine dinucleotide binding (IEA)

identical protein binding (IPI)

protein binding (ISO)

short-chain fatty acyl-CoA dehydrogenase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

maple syrup urine disease pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

propionic acidemia pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

valproic acid pharmacokinetics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Purification and characterization of isovaleryl coenzyme A dehydrogenase from rat liver mitochondria.	Ikeda Y and Tanaka K, J Biol Chem. 1983 Jan 25;258(2):1077-85.
4.	Biosynthesis of four rat liver mitochondrial acyl-CoA dehydrogenases: in vitro synthesis, import into mitochondria, and processing of their precursors in a cell-free system and in cultured cells.	Ikeda Y, etal., Arch Biochem Biophys. 1987 Feb 1;252(2):662-74.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Molecular cloning and nucleotide sequence of cDNAs encoding the precursors of rat long chain acyl-coenzyme A, short chain acyl-coenzyme A, and isovaleryl-coenzyme A dehydrogenases. Sequence homology of four enzymes of the acyl-CoA dehydrogenase family.	Matsubara Y, etal., J Biol Chem 1989 Sep 25;264(27):16321-31.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	Exon skipping in IVD RNA processing in isovaleric acidemia caused by point mutations in the coding region of the IVD gene.	Vockley J, etal., Am J Hum Genet 2000 Feb;66(2):356-67.
17.	Molecular characterization of four different classes of mutations in the isovaleryl-CoA dehydrogenase gene responsible for isovaleric acidemia.	Vockley J, etal., Am J Hum Genet. 1991 Jul;49(1):147-57.

Additional References at PubMed

PMID:3446585	PMID:3597357	PMID:7640268	PMID:9214289	PMID:12477932	PMID:14651853	PMID:15489334	PMID:18614015	PMID:23474214	PMID:25931508	PMID:26316108

Genomics

Comparative Map Data

Ivd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	126,305,584 - 126,326,016 (+)	NCBI		GRCr8
mRatBN7.2	3	105,851,710 - 105,872,144 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	105,851,683 - 105,872,575 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	109,524,766 - 109,545,235 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,120,320 - 118,140,785 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	115,780,686 - 115,801,150 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	110,669,355 - 110,689,789 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	110,669,312 - 110,690,173 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,207,292 - 117,227,726 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	105,374,429 - 105,394,861 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,270,846 - 105,291,661 (+)	NCBI
Celera	3	104,765,745 - 104,785,979 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

IVD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	40,405,795 - 40,435,947 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	40,405,485 - 40,435,947 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	40,697,996 - 40,728,146 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	38,484,978 - 38,498,355 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	38,484,977 - 38,498,355	NCBI
Celera	15	17,463,670 - 17,479,493 (+)	NCBI		Celera
Cytogenetic Map	15	q15.1	NCBI
HuRef	15	17,541,064 - 17,556,886 (+)	NCBI		HuRef
CHM1_1	15	40,817,565 - 40,833,386 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	38,212,996 - 38,243,333 (+)	NCBI		T2T-CHM13v2.0

Ivd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	118,692,475 - 118,713,388 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	118,692,435 - 118,713,390 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	118,861,959 - 118,882,909 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	118,861,954 - 118,882,909 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	118,687,736 - 118,707,093 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	118,553,441 - 118,572,798 (+)	NCBI		MGSCv36	mm8
Celera	2	120,013,107 - 120,032,696 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	59.64	NCBI

Ivd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	7,327,557 - 7,346,027 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	7,327,557 - 7,341,533 (+)	NCBI	ChiLan1.0	ChiLan1.0

IVD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	29,642,102 - 29,672,428 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	33,793,458 - 33,823,800 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	19,342,283 - 19,372,465 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	37,596,455 - 37,626,708 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	37,596,688 - 37,609,902 (+)	Ensembl	panpan1.1		panPan2

IVD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	7,584,122 - 7,594,599 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	7,584,086 - 7,594,150 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	7,637,893 - 7,648,417 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	7,709,948 - 7,720,478 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	7,688,665 - 7,720,482 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	7,634,265 - 7,644,784 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	7,740,300 - 7,750,859 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	7,869,140 - 7,879,708 (+)	NCBI		UU_Cfam_GSD_1.0

Ivd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	86,023,008 - 86,036,677 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	3,871,148 - 3,885,241 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	3,871,152 - 3,883,521 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IVD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	130,893,984 - 130,910,586 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	130,896,488 - 130,910,582 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	145,981,544 - 145,995,640 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IVD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	42,592,387 - 42,605,931 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	42,589,709 - 42,606,199 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	98,364,384 - 98,377,989 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Ivd
94 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	81
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000013829
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

D3Wox27

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,871,874 - 105,872,003 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	110,689,520 - 110,689,648	NCBI	Rnor6.0
Rnor_5.0	3	117,227,457 - 117,227,585	UniSTS	Rnor5.0
RGSC_v3.4	3	105,394,591 - 105,394,720	RGD	RGSC3.4
RGSC_v3.4	3	105,394,592 - 105,394,720	UniSTS	RGSC3.4
RGSC_v3.1	3	105,291,019 - 105,291,148	RGD
Celera	3	104,785,710 - 104,785,838	UniSTS
RH 3.4 Map	3	913.79	UniSTS
RH 3.4 Map	3	913.79	RGD
RH 2.0 Map	3	590.1	RGD
Cytogenetic Map	3	q35	UniSTS

D3Arb26

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,871,832 - 105,872,056 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	110,689,478 - 110,689,701	NCBI	Rnor6.0
Rnor_5.0	3	117,227,415 - 117,227,638	UniSTS	Rnor5.0
RGSC_v3.4	3	105,394,549 - 105,394,773	RGD	RGSC3.4
RGSC_v3.4	3	105,394,550 - 105,394,773	UniSTS	RGSC3.4
RGSC_v3.1	3	105,290,977 - 105,291,201	RGD
Celera	3	104,785,668 - 104,785,891	UniSTS
Cytogenetic Map	3	q35	UniSTS

AI463340

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,872,163 - 105,872,340 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	110,689,809 - 110,689,985	NCBI	Rnor6.0
Rnor_5.0	3	117,227,746 - 117,227,922	UniSTS	Rnor5.0
RGSC_v3.4	3	105,394,881 - 105,395,057	UniSTS	RGSC3.4
Celera	3	104,785,999 - 104,786,175	UniSTS
Cytogenetic Map	3	q35	UniSTS

AU048627

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,867,494 - 105,867,607 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	110,685,139 - 110,685,251	NCBI	Rnor6.0
Rnor_5.0	3	117,223,076 - 117,223,188	UniSTS	Rnor5.0
RGSC_v3.4	3	105,390,213 - 105,390,325	UniSTS	RGSC3.4
Celera	3	104,781,332 - 104,781,444	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J05031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M19867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013829 ⟹ ENSRNOP00000013829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	105,851,683 - 105,872,535 (+)	Ensembl
Rnor_6.0 Ensembl	3	110,669,312 - 110,690,173 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103671 ⟹ ENSRNOP00000086985

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	105,851,688 - 105,872,514 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107497 ⟹ ENSRNOP00000078431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	105,851,683 - 105,872,575 (+)	Ensembl

RefSeq Acc Id:

NM_012592 ⟹ NP_036724

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	126,305,584 - 126,326,016 (+)	NCBI
mRatBN7.2	3	105,851,710 - 105,872,144 (+)	NCBI
Rnor_6.0	3	110,669,355 - 110,689,789 (+)	NCBI
Rnor_5.0	3	117,207,292 - 117,227,726 (+)	NCBI
RGSC_v3.4	3	105,374,429 - 105,394,861 (+)	RGD
Celera	3	104,765,745 - 104,785,979 (+)	RGD

Sequence:

show sequence

CGGAGATGGCGACTGCAGTCCGGCTGCTGGGGCGGCGAGTTTCCAGTTGGAGACTGCGGCCTTT
ACCGTCGCCCCTTGCTGTCCCGCAGCGGGCCCACTCGATGTTGCCTGTGGATGATGATATCAAC
GGGCTAAACGAGGAGCAGAAGCAGCTTCGTCATACGATATCTAAGTTCGTTCAAGAGAACCTGG
CCCCCAAGGCCCAAGAGATTGATCAAAGCAATGACTTCAAGAACCTGAGAGAGTTCTGGAAGCA
GCTGGGAAGCCTGGGAGTCCTGGGCATCACAGCCCCCGTTCAGTATGGTGGCTCTGGCCTGGGC
TACCTAGAACATGTGTTGGTGATGGAAGAGATATCCCGGGCTTCAGCAGCTGTGGGGCTCAGCT
ATGGCGCTCACTCCAACCTCTGCATCAACCAGATTGTCCGCAATGGGAATGAGGCACAGAAAGA
GAAATATCTTCCCAAGCTCATCAGTGGTGAGTTCATCGGAGCCCTGGCCATGAGTGAGCCCAAC
GCTGGCTCTGACGTTGTCTCCATGAGGCTGAAAGCAGAGAAGAAAGGAGATCACTACGTTCTGA
ATGGCAACAAGTTCTGGATCACCAATGGCCCTGACGCTGATGTCCTAGTTGTCTATGCCAAGAC
AGACTTGACTGCTGTGCCTGCGTCTCGGGGCATCACAGCCTTCATTGTGGAAAAGGATATGCCT
GGTTTCAGCACCTCGAAGAAGCTGGACAAGCTAGGCATGAGGGGCTCCAACACCTGTGAGCTAG
TCTTTGAAGACTGCAAGGTTCCTGCTGCTAACATCCTGAGCCAAGAGAGTAAGGGTGTCTACGT
ACTGATGAGCGGGCTGGACCTAGAACGCCTGGTGCTGGCAGGTGGACCCCTTGGGATCATGCAG
GCTGTCCTGGACCACACCATTCCCTATTTGCATGTGAGGGAAGCCTTTGGCCAGAAGATCGGCC
AATTCCAGCTGATGCAGGGAAAGATGGCTGACATGTACACCCGCCTCATGGCATGTCGACAGTA
TGTCTACAATGTCGCCAGGGCCTGTGACGAGGGCCACATCACTGCCAAGGACTGTGCTGGTGTG
ATTCTGTATACAGCCGAGTGTGCCACACAAGTAGCCCTGGATGGCATTCAATGTTTAGGTGGAA
ATGGCTACATCAATGACTTCCCCATGGGCCGCTTTCTTCGAGATGCCAAACTGTACGAGATCGG
AGGTGGGACCAGTGAGGTGAGGCGGCTAGTCATTGGCAGAGCTTTCAACGCAGACTTCCGCTAA
CCTGGGGCCATCACCCTGCTCCCAGCAGCAGGAGACCTTTGGAAGCAGAGACGTGGCAGCCCTC
TGACTTGGCTAAGGAAGCTCTGCTGCTCAACTGCCCTCCTCTTGCCAGCCCTCTGCTCTTCGTG
AAGTCGGATTCTCCAGCCGTGCCAGCCAGTCAATCAAGAAAGCCTAAAATTCGGTCCCCAGCTC
CGGAAAAAAAAAAAAAAAGAACCAAAAGAAAGCCTAAAATGGCTGCTAAAAGGACTTTGGCTTT
TCTGGGGTTTGCAGGGAGGGTAACAGTGTCTGCGCCCTTGTTCTCTACTTCTGAATGTAGTAAC
CTCACCCTCTGGGGTAGCATATGACAGGTACCCAACTCCTTTTCGTGGGCAAGCCTCTGGCAGG
GGAGCTCTTTCTGTTGCAATGTAACAGAGGCATTGCCTCTTTCAATTGTCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036724	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41454	(Get FASTA)	NCBI Sequence Viewer
	AAA41459	(Get FASTA)	NCBI Sequence Viewer
	AAH88401	(Get FASTA)	NCBI Sequence Viewer
	EDL79883	(Get FASTA)	NCBI Sequence Viewer
	EDL79884	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013829.3
	ENSRNOP00000078431.1
	ENSRNOP00000086985.1
	ENSRNOP00055003194
	ENSRNOP00060036064
	ENSRNOP00065032042
GenBank Protein	P12007	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036724 ⟸ NM_012592
- Peptide Label:	precursor
- UniProtKB:	P12007 (UniProtKB/Swiss-Prot), A6HPD3 (UniProtKB/TrEMBL), A0A8I6A3D0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATAVRLLGRRVSSWRLRPLPSPLAVPQRAHSMLPVDDDINGLNEEQKQLRHTISKFVQENLAP KAQEIDQSNDFKNLREFWKQLGSLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASAAVGLSYG AHSNLCINQIVRNGNEAQKEKYLPKLISGEFIGALAMSEPNAGSDVVSMRLKAEKKGDHYVLNG NKFWITNGPDADVLVVYAKTDLTAVPASRGITAFIVEKDMPGFSTSKKLDKLGMRGSNTCELVF EDCKVPAANILSQESKGVYVLMSGLDLERLVLAGGPLGIMQAVLDHTIPYLHVREAFGQKIGQF QLMQGKMADMYTRLMACRQYVYNVARACDEGHITAKDCAGVILYTAECATQVALDGIQCLGGNG YINDFPMGRFLRDAKLYEIGGGTSEVRRLVIGRAFNADFR hide sequence

Ensembl Acc Id:

ENSRNOP00000013829 ⟸ ENSRNOT00000013829

Ensembl Acc Id:

ENSRNOP00000078431 ⟸ ENSRNOT00000107497

Ensembl Acc Id:

ENSRNOP00000086985 ⟸ ENSRNOT00000103671

Protein Domains

Acyl-CoA dehydrogenase/oxidase C-terminal Acyl-CoA dehydrogenase/oxidase N-terminal Acyl-CoA oxidase/dehydrogenase middle

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12007-F1-model_v2	AlphaFold	P12007	1-424	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692314

Promoter ID:

EPDNEW_R2839

Type:

multiple initiation site

Name:

Ivd_1

Description:

isovaleryl-CoA dehydrogenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	110,669,337 - 110,669,397	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2936	AgrOrtholog
BioCyc Gene	G2FUF-48227	BioCyc
BioCyc Pathway	LEU-DEG2-PWY [L-leucine degradation I]	BioCyc
BioCyc Pathway Image	LEU-DEG2-PWY	BioCyc
Ensembl Genes	ENSRNOG00000009421	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055002697	UniProtKB/Swiss-Prot
	ENSRNOG00060025127	UniProtKB/Swiss-Prot
	ENSRNOG00065023036	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000013829.6	UniProtKB/Swiss-Prot
	ENSRNOT00000103671.1	UniProtKB/TrEMBL
	ENSRNOT00000107497.1	UniProtKB/TrEMBL
	ENSRNOT00055004286	UniProtKB/Swiss-Prot
	ENSRNOT00060043516	UniProtKB/Swiss-Prot
	ENSRNOT00065039414	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.540.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.40.110.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Butyryl-CoA Dehydrogenase, subunit A, domain 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7193077	IMAGE-MGC_LOAD
InterPro	Acyl-CoA_DH_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_cen-dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_Oxase/DH_mid-dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCo_DH-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCo_DH/oxidase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/ox_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/ox_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AcylCoA_DH/oxidase_NM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IVD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24513	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93591	IMAGE-MGC_LOAD
NCBI Gene	24513	ENTREZGENE
PANTHER	ACYL-COA DEHYDROGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ISOVALERYL-COA DEHYDROGENASE, MITOCHONDRIAL-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Acyl-CoA_dh_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_dh_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Acyl-CoA_dh_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ivd	PhenoGen
PROSITE	ACYL_COA_DH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACYL_COA_DH_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009421	RatGTEx
	ENSRNOG00055002697	RatGTEx
	ENSRNOG00060025127	RatGTEx
	ENSRNOG00065023036	RatGTEx
Superfamily-SCOP	SSF47203	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56645	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC204526
UniProt	A0A8I5ZKU7_RAT	UniProtKB/TrEMBL
	A0A8I6A3D0	ENTREZGENE, UniProtKB/TrEMBL
	A6HPD2_RAT	UniProtKB/TrEMBL
	A6HPD3	ENTREZGENE, UniProtKB/TrEMBL
	IVD_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Ivd	isovaleryl-CoA dehydrogenase	Ivd	isovaleryl coenzyme A dehydrogenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ivd	Isovaleryl Coenzyme A dehydrogenase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the mitochondrial matrix	631718
gene_function	catalyzes alpha, beta-dehydroganation of acyl-CoA esters	631718
gene_transcript	homotetrameric flavoprotein 40-45 kDa in size	631718

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways