Symbol:
Sap30
Name:
sin3 associated polypeptide
RGD ID:
1619204
MGI Page
MGI
Description:
Predicted to enable transcription corepressor activity. Acts upstream of or within negative regulation of transcription by RNA polymerase II and skeletal muscle cell differentiation. Located in nucleus. Is expressed in several structures, including branchial arch; cerebral cortex; early embryo; limb bud; and sensory organ. Orthologous to human SAP30 (Sin3A associated protein 30).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
30 kDa Sin3-associated polypeptide; 30kD; 30kDa; histone deacetylase complex subunit SAP30; sin3 associated polypeptide, 30kD; sin3 corepressor complex subunit SAP30; sin3-associated polypeptide p30; sin3-associated polypeptide, 30 kDa; Sin3-associated protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SAP30 (Sin3A associated protein 30) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Sap30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sap30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SAP30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SAP30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sap30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SAP30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SAP30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sap30 (Sin3A associated protein 30) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SAP30 (Sin3A associated protein 30)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Rattus norvegicus (Norway rat):
Sap30 (Sin3A associated protein 30)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Sap30
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sap30
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 57,935,740 - 57,940,874 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 57,935,741 - 57,940,894 (-) Ensembl GRCm39 Ensembl GRCm38 8 57,482,702 - 57,487,860 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 57,482,707 - 57,487,860 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 59,961,499 - 59,966,657 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 60,374,867 - 60,379,999 (-) NCBI MGSCv36 mm8 Celera 8 60,121,756 - 60,126,914 (-) NCBI Celera Cytogenetic Map 8 B2 NCBI cM Map 8 29.85 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sap30 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1354225 6480464 Dihydrotestosterone results in increased expression of SAP30 mRNA CTD PMID:29581250 Sap30 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of SAP30 mRNA; [TIPARP gene more ... CTD PMID:16214954|PMID:25975270 Sap30 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SAP30 mRNA CTD PMID:21889950|PMID:26290441 Sap30 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SAP30 mRNA CTD PMID:21570461|PMID:26377647 Sap30 Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1354225 6480464 Lactic Acid results in decreased expression of SAP30 mRNA CTD PMID:30851411 Sap30 Mouse 2-methylcholine affects expression ISO RGD:1354225 6480464 beta-methylcholine affects the expression of SAP30 mRNA CTD PMID:21179406 Sap30 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1354225 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Sap30 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SAP30 mRNA CTD PMID:28973697 Sap30 Mouse 5-fluorouracil multiple interactions ISO RGD:1354225 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of SAP30 mRNA] CTD PMID:15016801 Sap30 Mouse aflatoxin B1 affects expression ISO RGD:1354225 6480464 Aflatoxin B1 affects the expression of SAP30 protein CTD PMID:20106945 Sap30 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SAP30 mRNA CTD PMID:19770486 Sap30 Mouse all-trans-retinoic acid decreases expression ISO RGD:1354225 6480464 Tretinoin results in decreased expression of SAP30 mRNA CTD PMID:15498508|PMID:21934132 Sap30 Mouse amphotericin B increases expression ISO RGD:1354225 6480464 Amphotericin B analog results in increased expression of SAP30 mRNA CTD PMID:28534445 Sap30 Mouse antirheumatic drug decreases expression ISO RGD:1354225 6480464 Antirheumatic Agents results in decreased expression of SAP30 mRNA CTD PMID:24449571 Sap30 Mouse arsenite(3-) multiple interactions ISO RGD:1354225 6480464 arsenite promotes the reaction [G3BP1 protein binds to SAP30 mRNA] CTD PMID:32406909 Sap30 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SAP30 mRNA CTD PMID:19770486 Sap30 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1354225 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of SAP30 mRNA CTD PMID:20382639 Sap30 Mouse bisphenol A multiple interactions ISO RGD:1354225 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Sap30 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SAP30 mRNA CTD PMID:32156529 Sap30 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of SAP30 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Sap30 Mouse cisplatin decreases expression ISO RGD:1354225 6480464 Cisplatin results in decreased expression of SAP30 mRNA CTD PMID:21603599|PMID:27392435 Sap30 Mouse cisplatin increases expression ISO RGD:1354225 6480464 Cisplatin results in increased expression of SAP30 mRNA CTD PMID:27594783 Sap30 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of SAP30 mRNA CTD PMID:27462272 Sap30 Mouse cobalt dichloride multiple interactions ISO RGD:1354225 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of SAP30 mRNA] CTD PMID:22202117 Sap30 Mouse cobalt dichloride increases expression ISO RGD:1354225 6480464 cobaltous chloride results in increased expression of SAP30 mRNA CTD PMID:19376846|PMID:22202117 Sap30 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos, Crocidolite results in decreased expression of SAP30 mRNA CTD PMID:29279043 Sap30 Mouse cyclosporin A affects expression ISO RGD:1354225 6480464 Cyclosporine affects the expression of SAP30 mRNA CTD PMID:20106945 Sap30 Mouse cyclosporin A decreases expression ISO RGD:1354225 6480464 Cyclosporine results in decreased expression of SAP30 mRNA CTD PMID:25562108 Sap30 Mouse DDE increases expression ISO RGD:1354225 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of SAP30 mRNA CTD PMID:38568856 Sap30 Mouse dexamethasone multiple interactions ISO RGD:1354225 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Sap30 Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of SAP30 mRNA CTD PMID:35093514 Sap30 Mouse dioxygen affects expression EXP 6480464 Oxygen deficiency affects the expression of SAP30 mRNA CTD PMID:17193925 Sap30 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SAP30 mRNA CTD PMID:25629700 Sap30 Mouse FR900359 increases phosphorylation ISO RGD:1354225 6480464 FR900359 results in increased phosphorylation of SAP30 protein CTD PMID:37730182 Sap30 Mouse GSK-J4 increases expression ISO RGD:1354225 6480464 GSK-J4 results in increased expression of SAP30 mRNA CTD PMID:29301935 Sap30 Mouse hydrogen peroxide affects expression ISO RGD:1354225 6480464 Hydrogen Peroxide affects the expression of SAP30 mRNA CTD PMID:20044591 Sap30 Mouse indometacin multiple interactions ISO RGD:1354225 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Sap30 Mouse isoflavones decreases expression ISO RGD:1354225 6480464 Isoflavones results in decreased expression of SAP30 mRNA CTD PMID:17374662 Sap30 Mouse ivermectin decreases expression ISO RGD:1354225 6480464 Ivermectin results in decreased expression of SAP30 protein CTD PMID:32959892 Sap30 Mouse manganese atom multiple interactions ISO RGD:1354225 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SAP30 more ... CTD PMID:39836092 Sap30 Mouse manganese(0) multiple interactions ISO RGD:1354225 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SAP30 more ... CTD PMID:39836092 Sap30 Mouse manganese(II) chloride multiple interactions ISO RGD:1354225 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of SAP30 more ... CTD PMID:39836092 Sap30 Mouse mercury atom increases expression ISO RGD:1354225 6480464 Mercury results in increased expression of SAP30 mRNA CTD PMID:16823088 Sap30 Mouse mercury(0) increases expression ISO RGD:1354225 6480464 Mercury results in increased expression of SAP30 mRNA CTD PMID:16823088 Sap30 Mouse okadaic acid increases expression ISO RGD:1354225 6480464 Okadaic Acid results in increased expression of SAP30 mRNA CTD PMID:38832940 Sap30 Mouse ozone multiple interactions ISO RGD:1354225 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SAP30 mRNA CTD PMID:35430440 Sap30 Mouse perfluorodecanoic acid increases expression ISO RGD:1354225 6480464 perfluorodecanoic acid results in increased expression of SAP30 mRNA CTD PMID:38568856 Sap30 Mouse perfluorooctanoic acid increases expression ISO RGD:1595501 6480464 perfluorooctanoic acid results in increased expression of SAP30 mRNA CTD PMID:35163327 Sap30 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of SAP30 mRNA CTD PMID:19270015 Sap30 Mouse pirinixic acid multiple interactions ISO RGD:1354225 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Sap30 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of SAP30 mRNA CTD PMID:18301758|PMID:23811191 Sap30 Mouse piroxicam decreases expression ISO RGD:1354225 6480464 Piroxicam results in decreased expression of SAP30 mRNA CTD PMID:21858171 Sap30 Mouse rac-lactic acid decreases expression ISO RGD:1354225 6480464 Lactic Acid results in decreased expression of SAP30 mRNA CTD PMID:30851411 Sap30 Mouse sodium arsenite increases stability ISO RGD:1354225 6480464 sodium arsenite results in increased stability of SAP30 mRNA CTD PMID:25493608 Sap30 Mouse sodium arsenite decreases expression ISO RGD:1354225 6480464 sodium arsenite results in decreased expression of SAP30 mRNA CTD PMID:38568856 Sap30 Mouse tamibarotene decreases expression ISO RGD:1354225 6480464 tamibarotene results in decreased expression of SAP30 mRNA CTD PMID:15498508 Sap30 Mouse temozolomide decreases expression ISO RGD:1354225 6480464 Temozolomide results in decreased expression of SAP30 mRNA CTD PMID:31758290 Sap30 Mouse tert-butyl hydroperoxide decreases expression ISO RGD:1354225 6480464 tert-Butylhydroperoxide results in decreased expression of SAP30 mRNA CTD PMID:15336504 Sap30 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SAP30 mRNA CTD PMID:27339419|PMID:31919559 Sap30 Mouse thalidomide decreases expression EXP 6480464 Thalidomide results in decreased expression of SAP30 mRNA CTD PMID:26217789 Sap30 Mouse thioacetamide increases expression ISO RGD:1595501 6480464 Thioacetamide results in increased expression of SAP30 mRNA CTD PMID:34492290 Sap30 Mouse thiram decreases expression ISO RGD:1354225 6480464 Thiram results in decreased expression of SAP30 mRNA CTD PMID:38568856 Sap30 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of SAP30 mRNA CTD PMID:29264374 Sap30 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SAP30 gene CTD PMID:35295148 Sap30 Mouse triphenyl phosphate affects expression ISO RGD:1354225 6480464 triphenyl phosphate affects the expression of SAP30 mRNA CTD PMID:37042841 Sap30 Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of SAP30 mRNA CTD PMID:28973697 Sap30 Mouse urethane increases expression ISO RGD:1354225 6480464 Urethane results in increased expression of SAP30 mRNA CTD PMID:28818685 Sap30 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SAP30 mRNA CTD PMID:17292431|PMID:17963808 Sap30 Mouse valproic acid increases expression ISO RGD:1354225 6480464 Valproic Acid results in increased expression of SAP30 mRNA CTD PMID:24935251|PMID:29154799 Sap30 Mouse zinc atom increases expression ISO RGD:1354225 6480464 Zinc deficiency results in increased expression of SAP30 mRNA CTD PMID:18356318 Sap30 Mouse zinc dichloride multiple interactions ISO RGD:1354225 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of SAP30 mRNA] CTD PMID:22202117 Sap30 Mouse zinc(0) increases expression ISO RGD:1354225 6480464 Zinc deficiency results in increased expression of SAP30 mRNA CTD PMID:18356318
Imported Annotations - PID (archival)
Sap30 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 57,935,740 - 57,940,874 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 57,935,741 - 57,940,894 (-) Ensembl GRCm39 Ensembl GRCm38 8 57,482,702 - 57,487,860 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 57,482,707 - 57,487,860 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 59,961,499 - 59,966,657 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 60,374,867 - 60,379,999 (-) NCBI MGSCv36 mm8 Celera 8 60,121,756 - 60,126,914 (-) NCBI Celera Cytogenetic Map 8 B2 NCBI cM Map 8 29.85 NCBI
SAP30 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 173,370,954 - 173,377,532 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 173,369,969 - 173,377,532 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 174,292,105 - 174,298,683 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 174,528,668 - 174,535,258 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 174,666,823 - 174,673,412 NCBI Celera 4 171,617,185 - 171,623,780 (+) NCBI Celera Cytogenetic Map 4 q34.1 NCBI HuRef 4 170,039,929 - 170,046,600 (+) NCBI HuRef CHM1_1 4 174,268,541 - 174,275,140 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 176,710,356 - 176,716,943 (+) NCBI T2T-CHM13v2.0
Sap30 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 37,758,494 - 37,763,825 (+) NCBI GRCr8 mRatBN7.2 16 32,747,777 - 32,753,114 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 32,747,734 - 32,753,112 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 36,340,519 - 36,345,780 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 39,751,855 - 39,757,120 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 35,971,643 - 35,976,917 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 36,115,942 - 36,121,310 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 36,116,258 - 36,121,097 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 35,925,181 - 35,930,571 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 36,169,061 - 36,175,458 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 16 32,686,875 - 32,692,135 (+) NCBI Celera Cytogenetic Map 16 p11 NCBI
Sap30 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 33,633,236 - 33,638,983 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 33,633,028 - 33,639,271 (-) NCBI ChiLan1.0 ChiLan1.0
SAP30 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 171,131,113 - 171,137,985 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 171,511,697 - 171,518,922 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 165,598,765 - 165,605,737 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 177,836,967 - 177,843,092 (+) NCBI panpan1.1 PanPan1.1 panPan2
SAP30 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 23,971,692 - 23,977,481 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 23,971,982 - 23,977,478 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 24,622,551 - 24,628,366 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 24,135,020 - 24,140,861 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 24,135,335 - 24,140,858 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 24,081,285 - 24,087,117 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 23,971,624 - 23,977,439 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 24,121,526 - 24,127,344 (+) NCBI UU_Cfam_GSD_1.0
Sap30 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 24,139,083 - 24,204,848 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936516 4,552,743 - 4,558,928 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936516 4,553,382 - 4,587,360 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SAP30
SAP30 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 119,481,790 - 119,488,348 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 119,481,772 - 119,488,354 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 99,503,539 - 99,510,212 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sap30
.
Predicted Target Of
Count of predictions: 59 Count of miRNA genes: 59 Interacting mature miRNAs: 59 Transcripts: ENSMUST00000034022 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1558870 Eae36_m experimental allergic encephalomyelitis susceptibility 36 (mouse) Not determined 8 14773160 71498244 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 4141437 W10q14_m weight 10 weeks QTL 14 (mouse) Not determined 32506572 71740637 Mouse 1301936 Trigq2_m triglyceride QTL 2 (mouse) Not determined 8 34290397 68290537 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 1301717 Adip4_m adiposity 4 (mouse) Not determined 8 48090064 82090180 Mouse 1357811 Orq3_m ovulation rate QTL 3 (mouse) Not determined 8 32506572 71740637 Mouse 1357715 Alaa3_m alopecia areata 3 (mouse) Not determined 8 49245591 83245673 Mouse 14746987 Manh64_m mandible shape 64 (mouse) 8 50505958 84505958 Mouse 4141172 W6q9_m weight 6 weeks QTL 9 (mouse) Not determined 32506572 71740637 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 14700686 Civq3_m cerebral infarct volume QTL 3 (mouse) 8 52334843 86334843 Mouse 10766453 Char11_m P. chabaudi malaria resistance QTL 11 (mouse) 8 48090064 82090180 Mouse 1301506 Aevm1_m autoimmune extremity vasculitis in MRL mice 1 (mouse) Not determined 8 54740461 88740637 Mouse 1301441 Skull11_m skull morphology 11 (mouse) Not determined 8 48190168 82190288 Mouse 1301952 Im3_m immunoregulatory 3 (mouse) Not determined 8 55159258 89159407 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 4140966 Egq12_m early growth QTL 12 (mouse) Not determined 32506572 71740637 Mouse 1301544 Iba3_m induction of brown adipocytes 3 (mouse) Not determined 8 44747914 78748059 Mouse 14747005 Mancz7_m mandible centroid size 7 (mouse) 8 50505958 84505958 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043974 Obq30_m obesity QTL 30 (mouse) Not determined 8 26583322 60583322 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034022 ⟹ ENSMUSP00000034022
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 57,935,741 - 57,940,894 (-) Ensembl GRCm38.p6 Ensembl 8 57,482,707 - 57,487,860 (-) Ensembl
RefSeq Acc Id:
NM_021788 ⟹ NP_068560
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 57,935,740 - 57,940,874 (-) NCBI GRCm38 8 57,482,702 - 57,487,860 (-) ENTREZGENE MGSCv37 8 59,961,499 - 59,966,657 (-) RGD Celera 8 60,121,756 - 60,126,914 (-) RGD cM Map 8 ENTREZGENE
Sequence:
CTCGCGCAGGTTCTGGGGTTGAGAAGGAGGCGGAGGAGCTGCGGTCCAACTGCTGAAGTCTCCATGTGACAGTGAGTGGGGTCTCCTTTCTAGGCGCCACTTCACTCCTGATCACAGTCACAGGACCT
hide sequence
RefSeq Acc Id:
NP_068560 ⟸ NM_021788
- UniProtKB:
A2RSE9 (UniProtKB/Swiss-Prot), Q99JB9 (UniProtKB/Swiss-Prot), O88574 (UniProtKB/Swiss-Prot)
- Sequence:
MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKR
hide sequence
Ensembl Acc Id:
ENSMUSP00000034022 ⟸ ENSMUST00000034022
RGD ID: 8667117 Promoter ID: EPDNEW_M11590 Type: initiation region Name: Sap30_2 Description: Mus musculus sin3 associated polypeptide , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11591 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 57,487,570 - 57,487,630 EPDNEW
RGD ID: 8667119 Promoter ID: EPDNEW_M11591 Type: initiation region Name: Sap30_1 Description: Mus musculus sin3 associated polypeptide , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11590 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 57,487,813 - 57,487,873 EPDNEW
RGD ID: 6843704 Promoter ID: MM_KWN:54469 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: AK141659_2500002B13RIK, ENSMUST00000034022 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 59,965,866 - 59,967,407 (-) MPROMDB
