Advanced Search (OLGA)

Gene: SELENOK (selenoprotein K) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

SELENOK

Name:

selenoprotein K

RGD ID:

1603383

HGNC Page

HGNC:30394

Description:

Enables identical protein binding activity. Involved in intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress; protein palmitoylation; and response to oxidative stress. Located in endoplasmic reticulum membrane.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

HSPC030; HSPC297; MGC17057; SELK

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Selenok (selenoprotein K)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Selenok (selenoprotein K)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Selenok (selenoprotein K)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	SELENOK (selenoprotein K)	NCBI	Ortholog
Canis lupus familiaris (dog):	SELENOK (selenoprotein K)	HGNC	HomoloGene, NCBI
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Selenok (selenoprotein K)	NCBI	Ortholog
Sus scrofa (pig):	SELENOK (selenoprotein K)	HGNC	NCBI
Chlorocebus sabaeus (green monkey):	SELENOK (selenoprotein K)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Selenok (selenoprotein K)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Pmp2 (peripheral myelin protein 2)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Selenok (selenoprotein K)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Selenok (selenoprotein K)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y41E3.8	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	selenok	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)

Related Pseudogenes:

SELENOKP1 SELENOKP2 SELENOKP3

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	53,884,417 - 53,891,859 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	53,884,417 - 53,891,885 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	53,918,444 - 53,925,886 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	53,894,266 - 53,901,029 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	53,886,504 - 53,893,267 (-)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	53,967,743 - 53,974,504 (-)	NCBI		HuRef
CHM1_1	3	53,870,843 - 53,877,606 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	53,917,657 - 53,925,099 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SELENOK	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Selenok (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOK mRNA	CTD	PMID:22206623
SELENOK	Human	1,2-dimethylhydrazine	decreases expression	ISO	Selenok (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of SELK mRNA	CTD	PMID:22206623
SELENOK	Human	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of SELENOK mRNA	CTD	PMID:20106945
SELENOK	Human	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol co-treated with Norethindrone Acetate] results in increased expression of SELENOK mRNA	CTD	PMID:22217510
SELENOK	Human	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of SELENOK mRNA	CTD	PMID:23019147
SELENOK	Human	17beta-hydroxy-5alpha-androstan-3-one	increases expression	EXP		6480464	Dihydrotestosterone results in increased expression of SELK mRNA	CTD	PMID:29581250
SELENOK	Human	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	Selenok (Rattus norvegicus)	6480464	2 more ...	CTD	PMID:31826744
SELENOK	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Selenok (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SELENOK mRNA	CTD	PMID:15034205 and PMID:18796159
SELENOK	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Selenok (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of SELENOK mRNA	CTD	PMID:26377647
SELENOK	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Selenok (Mus musculus)	6480464	[Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of SELENOK mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of SELENOK mRNA]	CTD	PMID:15034205 and PMID:16214954
SELENOK	Human	2-palmitoylglycerol	increases expression	EXP		6480464	2-palmitoylglycerol results in increased expression of SELENOK mRNA	CTD	PMID:37199045
SELENOK	Human	4,4'-diaminodiphenylmethane	decreases expression	ISO	Selenok (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of SELENOK mRNA	CTD	PMID:18648102
SELENOK	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Selenok (Mus musculus)	6480464	bisphenol S results in increased expression of SELENOK mRNA	CTD	PMID:39298647
SELENOK	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	Selenok (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA	CTD	PMID:36041667
SELENOK	Human	acrylamide	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	Acrylamide results in increased expression of SELK mRNA	CTD	PMID:28959563
SELENOK	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of SELENOK gene	CTD	PMID:27153756
SELENOK	Human	ammonium chloride	affects expression	ISO	Selenok (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of SELENOK mRNA	CTD	PMID:16483693
SELENOK	Human	arsane	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	arsenic acid	decreases expression	ISO	Selenok (Mus musculus)	6480464	arsenic acid results in decreased expression of SELENOK mRNA	CTD	PMID:19429247
SELENOK	Human	arsenic atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	arsenite(3-)	decreases expression	ISO	Selenok (Mus musculus)	6480464	arsenite results in decreased expression of SELENOK mRNA	CTD	PMID:19429247
SELENOK	Human	arsenite(3-)	multiple interactions	EXP		6480464	arsenite promotes the reaction [G3BP1 protein binds to SELENOK mRNA]	CTD	PMID:32406909
SELENOK	Human	benzo[a]pyrene	increases expression	ISO	Selenok (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SELENOK mRNA	CTD	PMID:15034205 and PMID:22228805
SELENOK	Human	benzo[a]pyrene	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	Benzo(a)pyrene results in increased expression of SELENOK mRNA	CTD	PMID:38278498
SELENOK	Human	benzo[a]pyrene	decreases methylation	EXP		6480464	Benzo(a)pyrene results in decreased methylation of SELK promoter	CTD	PMID:27901495
SELENOK	Human	benzo[a]pyrene	multiple interactions	ISO	Selenok (Mus musculus)	6480464	AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of SELENOK mRNA]	CTD	PMID:15034205
SELENOK	Human	Benzo[k]fluoranthene	increases expression	ISO	Selenok (Mus musculus)	6480464	benzo(k)fluoranthene results in increased expression of SELENOK mRNA	CTD	PMID:26377693
SELENOK	Human	beta-lapachone	increases expression	EXP		6480464	beta-lapachone results in increased expression of SELENOK mRNA	CTD	PMID:38218311
SELENOK	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	Selenok (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of SELENOK mRNA	CTD	PMID:33754040
SELENOK	Human	bisphenol A	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	bisphenol A results in increased expression of SELENOK mRNA	CTD	PMID:25181051
SELENOK	Human	bisphenol A	multiple interactions	ISO	Selenok (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA	CTD	PMID:36041667
SELENOK	Human	bisphenol A	increases expression	ISO	Selenok (Mus musculus)	6480464	bisphenol A results in increased expression of SELENOK mRNA	CTD	PMID:33221593
SELENOK	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SELK mRNA	CTD	PMID:30903817
SELENOK	Human	bisphenol F	decreases expression	ISO	Selenok (Mus musculus)	6480464	bisphenol F results in decreased expression of SELENOK mRNA	CTD	PMID:38685157
SELENOK	Human	bisphenol F	multiple interactions	ISO	Selenok (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA	CTD	PMID:36041667
SELENOK	Human	bisphenol F	multiple interactions	EXP		6480464	[bisphenol F co-treated with Fulvestrant] results in increased methylation of SELENOK gene	CTD	PMID:31601247
SELENOK	Human	bortezomib	increases expression	EXP		6480464	Bortezomib results in increased expression of SELENOK mRNA	CTD	PMID:20977926
SELENOK	Human	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of SELENOK mRNA	CTD	PMID:38568856
SELENOK	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to SELK gene]	CTD	PMID:28238834
SELENOK	Human	ciguatoxin CTX1B	affects expression	ISO	Selenok (Mus musculus)	6480464	Ciguatoxins affects the expression of SELENOK mRNA	CTD	PMID:18353800
SELENOK	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of SELENOK mRNA	CTD	PMID:19561079
SELENOK	Human	clobetasol	increases expression	ISO	Selenok (Mus musculus)	6480464	Clobetasol results in increased expression of SELENOK mRNA	CTD	PMID:27462272
SELENOK	Human	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of SELENOK mRNA	CTD	PMID:19320972
SELENOK	Human	copper atom	multiple interactions	EXP		6480464	[NSC 689534 binds to Copper] which results in increased expression of SELENOK mRNA	CTD	PMID:20971185
SELENOK	Human	copper(0)	multiple interactions	EXP		6480464	[NSC 689534 binds to Copper] which results in increased expression of SELENOK mRNA	CTD	PMID:20971185
SELENOK	Human	copper(II) chloride	increases expression	EXP		6480464	cupric chloride results in increased expression of SELENOK mRNA	CTD	PMID:17211630
SELENOK	Human	copper(II) sulfate	increases expression	EXP		6480464	Copper Sulfate results in increased expression of SELENOK mRNA	CTD	PMID:19549813
SELENOK	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of SELENOK mRNA	CTD	PMID:20106945 more ...
SELENOK	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of SELENOK mRNA	CTD	PMID:37042841
SELENOK	Human	dibutyl phthalate	increases expression	ISO	Selenok (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of SELENOK mRNA	CTD	PMID:21266533
SELENOK	Human	dicrotophos	decreases expression	EXP		6480464	dicrotophos results in decreased expression of SELENOK mRNA	CTD	PMID:28302478
SELENOK	Human	dioxygen	multiple interactions	ISO	Selenok (Mus musculus)	6480464	Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of SELENOK mRNA]	CTD	PMID:22629407
SELENOK	Human	dioxygen	increases expression	ISO	Selenok (Mus musculus)	6480464	Oxygen deficiency results in increased expression of SELENOK mRNA	CTD	PMID:22629407
SELENOK	Human	disodium selenite	increases expression	EXP		6480464	Sodium Selenite results in increased expression of SELENOK mRNA	CTD	PMID:18175754
SELENOK	Human	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of SELENOK mRNA	CTD	PMID:35967413
SELENOK	Human	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of SELENOK mRNA	CTD	PMID:29803840
SELENOK	Human	elemental selenium	affects expression	ISO	Selenok (Rattus norvegicus)	6480464	Selenium affects the expression of SELENOK mRNA	CTD	PMID:19106321
SELENOK	Human	ethanol	affects splicing	ISO	Selenok (Mus musculus)	6480464	Ethanol affects the splicing of SELK mRNA	CTD	PMID:30319688
SELENOK	Human	flutamide	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	Flutamide results in increased expression of SELENOK mRNA	CTD	PMID:24136188
SELENOK	Human	folic acid	multiple interactions	ISO	Selenok (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOK mRNA	CTD	PMID:22206623
SELENOK	Human	fulvestrant	multiple interactions	EXP		6480464	[bisphenol F co-treated with Fulvestrant] results in increased methylation of SELENOK gene	CTD	PMID:31601247
SELENOK	Human	gentamycin	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	Gentamicins results in increased expression of SELENOK mRNA	CTD	PMID:33387578
SELENOK	Human	glafenine	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	Glafenine results in increased expression of SELENOK mRNA	CTD	PMID:24136188
SELENOK	Human	manganese atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	manganese(0)	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	manganese(II) chloride	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	miconazole	increases expression	ISO	Selenok (Mus musculus)	6480464	Miconazole results in increased expression of SELENOK mRNA	CTD	PMID:27462272
SELENOK	Human	nickel atom	increases expression	EXP		6480464	Nickel results in increased expression of SELENOK mRNA	CTD	PMID:23195993
SELENOK	Human	nickel sulfate	increases expression	EXP		6480464	nickel sulfate results in increased expression of SELENOK mRNA	CTD	PMID:16780908
SELENOK	Human	nimesulide	increases expression	ISO	Selenok (Rattus norvegicus)	6480464	nimesulide results in increased expression of SELENOK mRNA	CTD	PMID:24136188
SELENOK	Human	paracetamol	decreases expression	ISO	Selenok (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of SELENOK mRNA	CTD	PMID:33387578
SELENOK	Human	reactive oxygen species	affects abundance	EXP		6480464	SELENOK protein affects the abundance of Reactive Oxygen Species	CTD	PMID:16962588
SELENOK	Human	selenium atom	affects expression	ISO	Selenok (Rattus norvegicus)	6480464	Selenium affects the expression of SELENOK mRNA	CTD	PMID:19106321
SELENOK	Human	silver atom	increases expression	EXP		6480464	Silver results in increased expression of SELK mRNA	CTD	PMID:26014281
SELENOK	Human	silver(0)	increases expression	EXP		6480464	Silver results in increased expression of SELK mRNA	CTD	PMID:26014281
SELENOK	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of SELENOK mRNA	CTD	PMID:38568856
SELENOK	Human	sodium arsenite	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA	CTD	PMID:39836092
SELENOK	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of SELENOK mRNA	CTD	PMID:34032870
SELENOK	Human	tert-butyl hydroperoxide	decreases expression	ISO	Selenok (Mus musculus)	6480464	tert-Butylhydroperoxide results in decreased expression of SELENOK mRNA	CTD	PMID:15003993
SELENOK	Human	thiram	increases expression	EXP		6480464	Thiram results in increased expression of SELENOK mRNA	CTD	PMID:38568856
SELENOK	Human	titanium dioxide	decreases methylation	ISO	Selenok (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SELK gene	CTD	PMID:35295148
SELENOK	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of SELENOK mRNA	CTD	PMID:37042841
SELENOK	Human	tunicamycin	increases expression	EXP		6480464	Tunicamycin results in increased expression of SELK mRNA	CTD	PMID:29453283
SELENOK	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of SELK mRNA	CTD	PMID:29154799
SELENOK	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of SELENOK mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SELENOK	Human	calcium ion transport	involved_in	IEA	UniProtKB-KW:KW-0109	150520179		UniProt	GO_REF:0000043
SELENOK	Human	calcium ion transport	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	calcium ion transport	involved_in	IBA	MGI:1931466 and PANTHER:PTN000423974	150520179		GO_Central	GO_REF:0000033
SELENOK	Human	endoplasmic reticulum calcium ion homeostasis	involved_in	IBA	FB:FBgn0030350 and PANTHER:PTN000423974	150520179		GO_Central	GO_REF:0000033
SELENOK	Human	establishment of localization in cell	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	involved_in	IMP		150520179	PMID:20692228	UniProt	PMID:20692228
SELENOK	Human	macrophage derived foam cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	150520179		UniProt	GO_REF:0000043
SELENOK	Human	neutrophil migration	acts_upstream_of	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of chemokine production	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of defense response to virus by host	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of interleukin-6 production	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of monocyte chemotactic protein-1 production	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of neutrophil migration	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of T cell migration	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of T cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	positive regulation of tumor necrosis factor production	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	protein palmitoylation	involved_in	IDA		150520179	PMID:25368151	UniProt	PMID:25368151
SELENOK	Human	protein palmitoylation	acts_upstream_of_or_within	ISO	MGI:4941878	9068941	PMID:23444136	MGI	PMID:23444136
SELENOK	Human	regulation of calcium-mediated signaling	involved_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	regulation of protein transport	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	regulation of store-operated calcium entry	NOT\|involved_in	ISO	Selenok (Mus musculus)	9068941	PMID:21220695	UniProt	PMID:21220695
SELENOK	Human	respiratory burst after phagocytosis	acts_upstream_of_or_within	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	response to oxidative stress	involved_in	IMP		150520179	PMID:16962588	UniProt	PMID:16962588
SELENOK	Human	T cell migration	acts_upstream_of	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	T cell proliferation	acts_upstream_of	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SELENOK	Human	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	150520179		UniProt	GO_REF:0000043
SELENOK	Human	endoplasmic reticulum	located_in	IDA		150520179	PMID:16962588 and PMID:25368151	UniProt	PMID:16962588 and PMID:25368151
SELENOK	Human	endoplasmic reticulum membrane	located_in	IDA		150520179	PMID:21220695	MGI	PMID:21220695
SELENOK	Human	endoplasmic reticulum membrane	is_active_in	IBA	MGI:1931466 more ...	150520179		GO_Central	GO_REF:0000033
SELENOK	Human	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	150520179		UniProt	GO_REF:0000044
SELENOK	Human	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:Q9JLJ1 and ensembl:ENSMUSP00000107887	150520179		Ensembl	GO_REF:0000107
SELENOK	Human	Golgi apparatus	is_active_in	IBA	FB:FBgn0030350 and PANTHER:PTN000423974	150520179		GO_Central	GO_REF:0000033
SELENOK	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
SELENOK	Human	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	150520179		UniProt	GO_REF:0000044
SELENOK	Human	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
SELENOK	Human	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
SELENOK	Human	identical protein binding	enables	IPI	UniProtKB:Q9Y6D0	150520179	PMID:25117454	IntAct	PMID:25117454
SELENOK	Human	protein binding	enables	IPI	UniProtKB:O15393-2 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
SELENOK	Human	protein binding	enables	IPI	UniProtKB:Q9H6R6	150520179	PMID:25368151	UniProt	PMID:25368151

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11042152	PMID:12477932	PMID:12775843	PMID:14702039	PMID:15489334	PMID:16341674	PMID:16962588	PMID:18029348	PMID:20692228	PMID:21048031	PMID:21220695	PMID:21516116
PMID:21873635	PMID:22016385	PMID:22119785	PMID:22810586	PMID:23133653	PMID:23142642	PMID:24144296	PMID:24623722	PMID:25117454	PMID:25368151	PMID:26272612	PMID:26504085
PMID:26567579	PMID:26735936	PMID:26972000	PMID:27275761	PMID:27609421	PMID:28130108	PMID:28298427	PMID:29540532	PMID:29599191	PMID:30082770	PMID:30526872	PMID:31073040
PMID:31980649	PMID:32296183	PMID:33845483	PMID:36538041	PMID:36610398	PMID:36805027	PMID:36949045	PMID:37023217	PMID:38252317	PMID:38320455	PMID:39155374

SELENOK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	53,884,417 - 53,891,859 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	53,884,417 - 53,891,885 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	53,918,444 - 53,925,886 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	53,894,266 - 53,901,029 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	53,886,504 - 53,893,267 (-)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	53,967,743 - 53,974,504 (-)	NCBI		HuRef
CHM1_1	3	53,870,843 - 53,877,606 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	53,917,657 - 53,925,099 (-)	NCBI		T2T-CHM13v2.0

Selenok
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	29,690,337 - 29,697,031 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	29,690,265 - 29,697,619 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	29,968,380 - 29,975,074 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	29,968,308 - 29,975,662 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	30,781,566 - 30,788,260 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	28,797,426 - 28,804,083 (+)	NCBI		MGSCv36	mm8
Celera	14	26,224,212 - 26,230,906 (+)	NCBI		Celera
Cytogenetic Map	14	A3	NCBI
cM Map	14	18.36	NCBI

Selenok
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	5,158,601 - 5,167,183 (+)	NCBI		GRCr8
mRatBN7.2	16	5,152,066 - 5,160,648 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	5,152,066 - 5,159,188 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	5,164,061 - 5,172,618 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	6,309,490 - 6,318,047 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	5,161,535 - 5,170,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	6,035,926 - 6,044,240 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	6,035,926 - 6,044,239 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	5,967,057 - 5,975,371 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	5,306,405 - 5,314,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	5,306,458 - 5,314,718 (+)	NCBI
Celera	16	10,023,918 - 10,032,235 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

Selenok
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955430	3,870,925 - 3,876,636 (-)	NCBI	ChiLan1.0	ChiLan1.0

SELENOK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	53,877,081 - 53,883,873 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	53,881,755 - 53,888,643 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	53,823,135 - 53,829,957 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	55,044,026 - 55,050,960 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	55,044,789 - 55,047,450 (-)	Ensembl	panpan1.1		panPan2

SELENOK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	36,109,095 - 36,115,792 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	36,109,148 - 36,115,856 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	36,046,592 - 36,053,289 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	36,383,192 - 36,389,892 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	36,383,245 - 36,389,965 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	35,825,109 - 35,831,800 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	36,183,706 - 36,190,402 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	36,400,934 - 36,407,849 (+)	NCBI		UU_Cfam_GSD_1.0

Selenok
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	171,407,613 - 171,414,243 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	4,545,961 - 4,552,822 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936473	4,546,186 - 4,552,764 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SELENOK
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	35,990,182 - 35,996,853 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	35,989,461 - 35,996,824 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	39,060,209 - 39,067,575 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SELENOK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	15,267,915 - 15,274,861 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	151,616,322 - 151,623,390 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Selenok
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624822	3,309,170 - 3,314,882 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in SELENOK
10 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 3p21.31-14.3(chr3:49461000-55314500)x1	copy number loss	See cases [RCV000051511]	Chr3:49461000..55314500 [GRCh38] Chr3:49498433..55348528 [GRCh37] Chr3:49473437..55323568 [NCBI36] Chr3:3p21.31-14.3	pathogenic
GRCh38/hg38 3p21.1-14.3(chr3:53287477-57025368)x1	copy number loss	See cases [RCV000053929]	Chr3:53287477..57025368 [GRCh38] Chr3:53321495..57059396 [GRCh37] Chr3:53296535..57034436 [NCBI36] Chr3:3p21.1-14.3	uncertain significance
GRCh38/hg38 3p21.2-14.3(chr3:51394434-55064449)x1	copy number loss	See cases [RCV000143631]	Chr3:51394434..55064449 [GRCh38] Chr3:51431865..55098476 [GRCh37] Chr3:51406905..55073516 [NCBI36] Chr3:3p21.2-14.3	likely pathogenic
GRCh37/hg19 3p21.2-14.2(chr3:52086599-59689209)x1	copy number loss	See cases [RCV000239886]	Chr3:52086599..59689209 [GRCh37] Chr3:3p21.2-14.2	pathogenic
GRCh37/hg19 3p26.3-q29(chr3:61892-197851986)	copy number gain	See cases [RCV000512358]	Chr3:61892..197851986 [GRCh37] Chr3:3p26.3-q29	pathogenic
GRCh37/hg19 3p26.3-q29(chr3:61892-197851986)x3	copy number gain	See cases [RCV000511055]	Chr3:61892..197851986 [GRCh37] Chr3:3p26.3-q29	pathogenic
NM_021237.5(SELENOK):c.10A>G (p.Ile4Val)	single nucleotide variant	not specified [RCV004331146]	Chr3:53891779 [GRCh38] Chr3:53925806 [GRCh37] Chr3:3p21.1	uncertain significance
GRCh37/hg19 3p21.1(chr3:53892719-54182466)x3	copy number gain	not provided [RCV000682258]	Chr3:53892719..54182466 [GRCh37] Chr3:3p21.1	likely benign
GRCh37/hg19 3p26.3-q29(chr3:61495-197838262)x3	copy number gain	not provided [RCV000742138]	Chr3:61495..197838262 [GRCh37] Chr3:3p26.3-q29	pathogenic
GRCh37/hg19 3p26.3-q29(chr3:60174-197948027)x3	copy number gain	not provided [RCV000742133]	Chr3:60174..197948027 [GRCh37] Chr3:3p26.3-q29	pathogenic
GRCh37/hg19 3p21.1(chr3:53413246-53955646)x3	copy number gain	not provided [RCV000847484]	Chr3:53413246..53955646 [GRCh37] Chr3:3p21.1	uncertain significance
GRCh37/hg19 3p21.1-14.3(chr3:53659716-54500525)x3	copy number gain	not specified [RCV003986453]	Chr3:53659716..54500525 [GRCh37] Chr3:3p21.1-14.3	uncertain significance
GRCh37/hg19 3p21.2-14.2(chr3:51149374-59265315)x1	copy number loss	not specified [RCV003986409]	Chr3:51149374..59265315 [GRCh37] Chr3:3p21.2-14.2	pathogenic
GRCh37/hg19 3p21.1(chr3:53532755-54395791)x3	copy number gain	not specified [RCV003986463]	Chr3:53532755..54395791 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.220A>T (p.Met74Leu)	single nucleotide variant	not specified [RCV004450352]	Chr3:53885887 [GRCh38] Chr3:53919914 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.265G>T (p.Ala89Ser)	single nucleotide variant	not specified [RCV004450353]	Chr3:53885842 [GRCh38] Chr3:53919869 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.41G>A (p.Ser14Asn)	single nucleotide variant	not specified [RCV004450355]	Chr3:53888462 [GRCh38] Chr3:53922489 [GRCh37] Chr3:3p21.1	likely benign
NM_021237.5(SELENOK):c.38G>A (p.Arg13Gln)	single nucleotide variant	not specified [RCV004450354]	Chr3:53888465 [GRCh38] Chr3:53922492 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.101T>C (p.Val34Ala)	single nucleotide variant	not specified [RCV004663717]	Chr3:53888402 [GRCh38] Chr3:53922429 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.26T>C (p.Val9Ala)	single nucleotide variant	not specified [RCV004663716]	Chr3:53888477 [GRCh38] Chr3:53922504 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.215G>A (p.Arg72Gln)	single nucleotide variant	not specified [RCV004663718]	Chr3:53885892 [GRCh38] Chr3:53919919 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.202G>A (p.Gly68Arg)	single nucleotide variant	not specified [RCV004663721]	Chr3:53885905 [GRCh38] Chr3:53919932 [GRCh37] Chr3:3p21.1	uncertain significance
NM_021237.5(SELENOK):c.241C>T (p.Arg81Cys)	single nucleotide variant	not specified [RCV004861689]	Chr3:53885866 [GRCh38] Chr3:53919893 [GRCh37] Chr3:3p21.1	uncertain significance
GRCh37/hg19 3p21.2-21.1(chr3:51962412-53969609)x1	copy number loss	not provided [RCV004819336]	Chr3:51962412..53969609 [GRCh37] Chr3:3p21.2-21.1	pathogenic

Predicted Target Of

	Summary Value
Count of predictions:	835
Count of miRNA genes:	484
Interacting mature miRNAs:	523
Transcripts:	ENST00000485414, ENST00000487571, ENST00000488746, ENST00000495461, ENST00000541726
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298487	BFD1_H	Body fluid distribution QTL 1 (human)	3.94		Body fluid distribution	impedance ratio	3	36380712	62380712	Human
1298489	RA4_H	Rheumatoid arthritis QTL 4 (human)		0.0283	Joint/bone inflammation	rheumatoid arthritis	3	36380712	62380712	Human
1643509	BW293_H	Body Weight QTL 293 (human)	1.42		Body weight	BMI	3	36380712	62380712	Human
2289308	BW392_H	Body weight QTL 392 (human)	1.42		Body weight	BMI	3	36380712	62380712	Human
1331643	COPD16_H	Chronic obstructive pulmonary disease QTL 16 (human)	1.07		Chronic airflow obstruction	post-BD FEV1 minus pre-BD FEV1/pre-BD FEV1 x 100	3	49380651	75380651	Human

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1950	465	2270	7305	6471	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_021237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC012467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF085359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF161415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF537132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ712004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK123406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK289594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC013162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM762385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HY005604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000485414

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	53,888,395 - 53,891,885 (-)	Ensembl

Ensembl Acc Id:

ENST00000487571

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	53,887,996 - 53,891,855 (-)	Ensembl

Ensembl Acc Id:

ENST00000488746 ⟹ ENSP00000417272

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	53,885,301 - 53,891,865 (-)	Ensembl

Ensembl Acc Id:

ENST00000495461 ⟹ ENSP00000418813

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	53,884,417 - 53,891,859 (-)	Ensembl

Ensembl Acc Id:

ENST00000541726 ⟹ ENSP00000443164

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	3	53,885,200 - 53,891,962 (-)	Ensembl

RefSeq Acc Id:

NM_021237 ⟹ NP_067060

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	3	53,884,417 - 53,891,859 (-)	NCBI
GRCh37	3	53,919,226 - 53,925,989 (-)	RGD
Build 36	3	53,894,266 - 53,901,029 (-)	NCBI Archive
Celera	3	53,886,504 - 53,893,267 (-)	RGD
HuRef	3	53,967,743 - 53,974,504 (-)	ENTREZGENE
CHM1_1	3	53,870,843 - 53,877,606 (-)	NCBI
T2T-CHM13v2.0	3	53,917,657 - 53,925,099 (-)	NCBI

Sequence:

show sequence

GAGCAGAGGGAGATACAGAAACCGACAGGGGCCAGGCGCCCGGTGGCTCCGAAGCGGGGAAGTGGGACAAGATGGTTTACATCTCGAACGGACAAGTGTTGGACAGCCGGAGTCAGTCTCCATGGAGA
TTATCTTTGATAACAGATTTCTTCTGGGGAATAGCTGAGTTTGTGGTTTTGTTTTTCAAAACTCTGCTTCAGCAAGATGTGAAAAAAAGAAGAAGCTATGGAAACTCATCTGATTCCAGATATGATGA
TGGAAGAGGGCCACCAGGAAACCCTCCCCGAAGAATGGGTAGAATCAATCATCTGCGTGGCCCTAGTCCCCCTCCAATGGCTGGTGGATGAGGAAGGTAAATGTCTGCTCTAAGAAGCAGACAACCGG
ACATGCGCATTCATAGCAGAAGGAAACCATCAAGAAGTGGAAGGCTGACCATGATGAGCAGTAGATGAATGTGTATGTCTAAACAAGGACTGCTCTGTGTCCTCACAGATGAATGAGGTCATGCTGGG
AATTCCCTCTGCAGGGAACTGGCCTGACTGACATGCAGTTCCATAAATGCAGATGTTTGTCTCATTACCTTTTTGTATAGTTTATTAAAGTATTAATATAGTTTTAATAAGTAAATATTTTTAGGTTG
CAGAATGGACTCCTCATCTTTATATTCACGAAAAAGCAATCTGAAGAAAACAAATAAAAGCCTGTGTATTTAGCACTGTTAGTGTCACCTTTTCAACTTCTGAAACACTGTTCATTGTTAACTTTTTC
TCATTTATAAATCACTGTATTTATTTTAGTAGTATGCATAGCATATCTGTGCTCTTGAATTAATTTTTATCTTTAACATATTTGTCTCATCAATCTTTAATACACTGTGTCTAATTTGCTACCAAATG
TAATTATCAGGGTATTTATAAAACCATAGCTAACAAAACTGAGCTACAAAATGAAAATTTACTAAATAGTTTTTAAAATCATGGACTTCAGCCTGGCGCGGTGGCTCATGCCTGTAATCCCAGCACTG
TGGGAGGCTGAGGCGGGCAGATCGCCTAAGTTCACGAGTTTGAGACCAGCCTGCAGCATGACGAAACCTAAAATAACAAAAATTAGCCAGGCGTGGTAGAGTGCACCTGTAATCCCTGCTACTCAGGA
GGCGGAGGCAGGAGAATCGCTTCAACCCGGGAGGCGGAGGTTGCTGTGAGCATGCCACTGCACTCCTGCCTAGGCAACAGAGTGAGACCCTGTCTCAAAAAAATAAATAAAACCATGGGCTTCCATGC
TATCTTGACAAATTTGCACTCTATAGCATCACTCAAAATACTGCCTATTGGCTTTAAACTCCATCTGAATACTGATAACTTTCACATTCTTTCACTAGAGTGGAAGCTCTGAGACTAGGAATTTTGTT
GTCTTTACCCCAGTCCTTTGAATAGTGACTACATGTAAGATAGTCATGTAGTATTTATTGGAAATAAATATTTATTGGAAAAACGAAAA

hide sequence


Protein RefSeqs	NP_067060	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD40194	(Get FASTA)	NCBI Sequence Viewer
	AAF28975	(Get FASTA)	NCBI Sequence Viewer
	AAH13162	(Get FASTA)	NCBI Sequence Viewer
	AAN61473	(Get FASTA)	NCBI Sequence Viewer
	BAF82283	(Get FASTA)	NCBI Sequence Viewer
	EAW65301	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000418813
	ENSP00000418813.1
GenBank Protein	Q9Y6D0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_067060 ⟸ NM_021237
- UniProtKB:	Q8IZQ3 (UniProtKB/Swiss-Prot), Q9P085 (UniProtKB/Swiss-Prot), Q9Y6D0 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR hide sequence

Ensembl Acc Id:

ENSP00000443164 ⟸ ENST00000541726

Ensembl Acc Id:

ENSP00000418813 ⟸ ENST00000495461

Ensembl Acc Id:

ENSP00000417272 ⟸ ENST00000488746

RGD ID:

6801644

Promoter ID:

HG_KWN:45300

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4

Transcripts:

NM_021237

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	3	53,900,576 - 53,901,607 (-)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	SELENOK	COSMIC
Ensembl Genes	ENSG00000113811	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000495461	ENTREZGENE
	ENST00000495461.6	UniProtKB/Swiss-Prot
GTEx	ENSG00000113811	GTEx
HGNC ID	HGNC:30394	ENTREZGENE
Human Proteome Map	SELENOK	Human Proteome Map
InterPro	Se_SelK/SelG	UniProtKB/Swiss-Prot
KEGG Report	hsa:58515	UniProtKB/Swiss-Prot
NCBI Gene	58515	ENTREZGENE
OMIM	607916	OMIM
PANTHER	PTHR16875	UniProtKB/Swiss-Prot
	SELENOPROTEIN K	UniProtKB/Swiss-Prot
Pfam	SelK_SelG	UniProtKB/Swiss-Prot
PharmGKB	PA166181630	PharmGKB
UniProt	F8WAX7_HUMAN	UniProtKB/TrEMBL
	Q8IZQ3	ENTREZGENE
	Q9P085	ENTREZGENE
	Q9Y6D0	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q8IZQ3	UniProtKB/Swiss-Prot
	Q9P085	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-27	SELENOK	selenoprotein K	SELK	selenoprotein K	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message