Selenok (selenoprotein K) - Rat Genome Database

Name: Selenok
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Selenok (selenoprotein K) Rattus norvegicus

Analyze

Symbol:

Selenok

Name:

selenoprotein K

RGD ID:

1303129

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress; positive regulation of cytokine production; and positive regulation of defense response to virus by host. Predicted to act upstream of or within several processes, including macrophage derived foam cell differentiation; positive regulation of leukocyte migration; and respiratory burst after phagocytosis. Predicted to be located in endoplasmic reticulum. Predicted to be active in Golgi apparatus and endoplasmic reticulum membrane. Orthologous to human SELENOK (selenoprotein K); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 4,4'-sulfonyldiphenol; acrylamide.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

heat shock protein; LOC290549; Selk

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SELENOK (selenoprotein K)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Selenok (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Selenok (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SELENOK (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SELENOK (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Selenok (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SELENOK (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SELENOK (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Selenok (selenoprotein K)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SELENOK (selenoprotein K)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Selenok (selenoprotein K)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y41E3.8	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	selenok	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Selenok-ps1 Selenok-ps2 Selenok-ps3 Selenok-ps4 Selenok-ps5 Selenok-ps6

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	5,158,601 - 5,167,183 (+)	NCBI		GRCr8
mRatBN7.2	16	5,152,066 - 5,160,648 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	5,152,066 - 5,159,188 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	5,164,061 - 5,172,618 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	6,309,490 - 6,318,047 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	5,161,535 - 5,170,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	6,035,926 - 6,044,240 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	6,035,926 - 6,044,239 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	5,967,057 - 5,975,371 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	5,306,405 - 5,314,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	5,306,458 - 5,314,718 (+)	NCBI
Celera	16	10,023,918 - 10,032,235 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-palmitoylglycerol (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsenic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

bortezomib (ISO)

CGP 52608 (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

disodium selenite (ISO)

diuron (ISO)

doxorubicin (ISO)

elemental selenium (EXP)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glafenine (EXP)

miconazole (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nimesulide (EXP)

paracetamol (EXP)

reactive oxygen species (ISO)

selenium atom (EXP)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion transport (IBA,IEA,ISO)

endoplasmic reticulum calcium ion homeostasis (IBA,IEA)

establishment of localization in cell (ISO)

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (ISO)

macrophage derived foam cell differentiation (ISO)

neutrophil migration (ISO)

positive regulation of chemokine production (ISO)

positive regulation of defense response to virus by host (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of monocyte chemotactic protein-1 production (ISO)

positive regulation of neutrophil migration (ISO)

positive regulation of T cell migration (ISO)

positive regulation of T cell proliferation (ISO)

positive regulation of tumor necrosis factor production (ISO)

regulation of calcium-mediated signaling (ISO)

regulation of protein transport (ISO)

regulation of store-operated calcium entry (ISO)

respiratory burst after phagocytosis (ISO)

response to oxidative stress (ISO)

T cell migration (ISO)

T cell proliferation (ISO)

Cellular Component

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IBA,IEA,ISO,ISS)

Golgi apparatus (IBA,IEA)

plasma membrane (IEA)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterization of mammalian selenoproteomes.	Kryukov GV, etal., Science 2003 May 30;300(5624):1439-43.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15277470	PMID:16962588	PMID:20692228	PMID:21220695	PMID:21849499	PMID:23444136	PMID:25117454	PMID:25368151	PMID:27645994

Genomics

Comparative Map Data

Selenok
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	5,158,601 - 5,167,183 (+)	NCBI		GRCr8
mRatBN7.2	16	5,152,066 - 5,160,648 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	5,152,066 - 5,159,188 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	5,164,061 - 5,172,618 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	6,309,490 - 6,318,047 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	5,161,535 - 5,170,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	6,035,926 - 6,044,240 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	6,035,926 - 6,044,239 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	5,967,057 - 5,975,371 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	5,306,405 - 5,314,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	5,306,458 - 5,314,718 (+)	NCBI
Celera	16	10,023,918 - 10,032,235 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

SELENOK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	53,884,417 - 53,891,859 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	53,884,417 - 53,891,885 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	53,918,444 - 53,925,886 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	53,894,266 - 53,901,029 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	53,886,504 - 53,893,267 (-)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	53,967,743 - 53,974,504 (-)	NCBI		HuRef
CHM1_1	3	53,870,843 - 53,877,606 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	53,917,657 - 53,925,099 (-)	NCBI		T2T-CHM13v2.0

Selenok
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	29,690,337 - 29,697,031 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	29,690,265 - 29,697,619 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	29,968,380 - 29,975,074 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	29,968,308 - 29,975,662 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	30,781,566 - 30,788,260 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	28,797,426 - 28,804,083 (+)	NCBI		MGSCv36	mm8
Celera	14	26,224,212 - 26,230,906 (+)	NCBI		Celera
Cytogenetic Map	14	A3	NCBI
cM Map	14	18.36	NCBI

Selenok
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955430	3,870,925 - 3,876,636 (-)	NCBI	ChiLan1.0	ChiLan1.0

SELENOK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	53,877,081 - 53,883,873 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	53,881,755 - 53,888,643 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	53,823,135 - 53,829,957 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	55,044,026 - 55,050,960 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	55,044,789 - 55,047,450 (-)	Ensembl	panpan1.1		panPan2

SELENOK
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	36,109,095 - 36,115,792 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	36,109,148 - 36,115,856 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	36,046,592 - 36,053,289 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	36,383,192 - 36,389,892 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	36,383,245 - 36,389,965 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	35,825,109 - 35,831,800 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	36,183,706 - 36,190,402 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	36,400,934 - 36,407,849 (+)	NCBI		UU_Cfam_GSD_1.0

Selenok
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	171,407,613 - 171,414,243 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	4,545,961 - 4,552,822 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936473	4,546,186 - 4,552,764 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SELENOK
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	35,990,182 - 35,996,853 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	35,989,461 - 35,996,824 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	39,060,209 - 39,067,575 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SELENOK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	15,267,915 - 15,274,861 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	151,616,322 - 151,623,390 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Selenok
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624822	3,309,170 - 3,314,882 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Selenok
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	50
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000020284
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	9639137	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	2851709	15884239	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	16039848	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat

Markers in Region

BF389195

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	5,156,741 - 5,156,985 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	6,040,602 - 6,040,845	NCBI	Rnor6.0
Rnor_5.0	16	5,971,733 - 5,971,976	UniSTS	Rnor5.0
RGSC_v3.4	16	5,311,081 - 5,311,326	UniSTS	RGSC3.4
Celera	16	10,027,313 - 10,027,556	UniSTS
RH 3.4 Map	16	11.4	UniSTS
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY319924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF979418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM129423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020284 ⟹ ENSRNOP00000020284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	5,152,066 - 5,159,188 (+)	Ensembl
Rnor_6.0 Ensembl	16	6,035,926 - 6,044,239 (+)	Ensembl

RefSeq Acc Id:

NM_207589 ⟹ NP_997472

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	5,158,601 - 5,167,183 (+)	NCBI
mRatBN7.2	16	5,152,066 - 5,160,648 (+)	NCBI
Rnor_6.0	16	6,035,926 - 6,044,240 (+)	NCBI
Rnor_5.0	16	5,967,057 - 5,975,371 (+)	NCBI
RGSC_v3.4	16	5,306,405 - 5,314,721 (+)	RGD
Celera	16	10,023,918 - 10,032,235 (-)	RGD

Sequence:

show sequence

GACGTAAGGGTGGGGCGGGAGGGGAGGTACGGCAACATCAGGGCGTCCGGTCTTCTCTGTCGCT
AGGAAGCGGGCAACCGGAGGAAAGATGGTTTACATCTCGAATGGTCAGGTGTTAGACAGCCGGA
ATCAGTCCCCCTGGAGATTGTCTTTCATAACAGATTTCTTCTGGGGAATAGCAGAATTTGTGGT
TTTTTTTTTCAAAACTCTGCTTCAGCAAGATGTGAAGAAAAGAAGAGGCTACGGGGGCTCCTCT
GATTCCAGATATGATGACGGAAGAGGGCCACCAGGAAACCCTCCACGAAGAATGGGTCGGATCA
GTCACCTTCGTGGCCCCAGCCCTCCTCCAATGGCCGGTGGATGAGGAAGGTAAACGTCTGCTCT
GAGAAGCAGACAACTAGACATACACGCCTAGAAGGGAACCATCAAGAGGTGAGGAGCGGCTCAT
GAGGAGAAGATGGTGTATGTCCAAACAAGGACTGCTCTGTGTCCTCACAGAAGAATGAGGTCAT
GCTGGGAACTCCCTCTGCAGGATCTGGCCTGACTGATGTGCAGTTCTATAAATGTACATGTGTG
TCTCCTTATCTGTTTTGTATAGTTCACTAAAGTTAATATAGATTTAAGAAGTAAATATTTTTAG
GTTGCAAAACTTGATTCTTCATCTTTATATGATTATACCCAAAATCCTTGATCTGGAAGAAATA
AAGGCCATGTAGTTAGTCCTGGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997472	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88086	(Get FASTA)	NCBI Sequence Viewer
	AAP73816	(Get FASTA)	NCBI Sequence Viewer
	EDL89012	(Get FASTA)	NCBI Sequence Viewer
	EDL89013	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020284
	ENSRNOP00000020284.7
	ENSRNOP00055028541
	ENSRNOP00060018423
	ENSRNOP00065019920
GenBank Protein	P59798	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997472 ⟸ NM_207589
- UniProtKB:	Q5I0Q3 (UniProtKB/Swiss-Prot), P59798 (UniProtKB/Swiss-Prot), A0A0G2JSN7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVYISNGQVLDSRNQSPWRLSFITDFFWGIAEFVVFFFKTLLQQDVKKRRGYGGSSDSRYDDGR GPPGNPPRRMGRISHLRGPSPPPMAGGUGR hide sequence

RefSeq Acc Id:

ENSRNOP00000020284 ⟸ ENSRNOT00000020284

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699906

Promoter ID:

EPDNEW_R10430

Type:

initiation region

Name:

Selenok_1

Description:

selenoprotein K

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	6,035,977 - 6,036,037	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303129	AgrOrtholog
BioCyc Gene	G2FUF-12208	BioCyc
Ensembl Genes	ENSRNOG00000014624	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055020634	UniProtKB/Swiss-Prot
	ENSRNOG00060013604	UniProtKB/Swiss-Prot
	ENSRNOG00065015314	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020284	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000020284.7	UniProtKB/Swiss-Prot
	ENSRNOT00055035208	UniProtKB/Swiss-Prot
	ENSRNOT00060023224	UniProtKB/Swiss-Prot
	ENSRNOT00065025395	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7326199	IMAGE-MGC_LOAD
InterPro	Se_SelK/SelG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:290549	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108512	IMAGE-MGC_LOAD
NCBI Gene	290549	ENTREZGENE
PANTHER	PTHR16875	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SELENOPROTEIN K	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SelK_SelG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Selenok	PhenoGen
RatGTEx	ENSRNOG00000014624	RatGTEx
	ENSRNOG00055020634	RatGTEx
	ENSRNOG00060013604	RatGTEx
	ENSRNOG00065015314	RatGTEx
UniProt	A0A0G2JSN7	ENTREZGENE, UniProtKB/TrEMBL
	P59798	ENTREZGENE
	Q5I0Q3	ENTREZGENE
	SELK_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q5I0Q3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-28	Selenok	selenoprotein K	Selk	selenoprotein K	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Selk	selenoprotein K	LOC290549	heat shock protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-11	LOC290549	heat shock protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar