Advanced Search (OLGA)

Gene: Rab36 (RAB36, member RAS oncogene family) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rab36

Name:

RAB36, member RAS oncogene family

RGD ID:

1596098

Description:

Predicted to enable GTP binding activity and GTPase activity. Predicted to be involved in vesicle-mediated transport. Orthologous to human RAB36 (RAB36, member RAS oncogene family); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC690407; ras-related protein Rab-36; similar to RAB36, member RAS oncogene family

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB36 (RAB36, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab36 (RAB36, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAB36 (RAB36, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab36 (RAB36, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab36 (RAB36, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RabX5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab36	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	13,606,086 - 13,624,208 (-)	NCBI		GRCr8
mRatBN7.2	20	13,606,700 - 13,624,304 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	13,608,136 - 13,624,170 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	14,314,630 - 14,330,407 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	13,675,463 - 13,691,240 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	14,148,058 - 14,163,835 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	14,557,485 - 14,573,939 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	14,557,740 - 14,573,519 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	16,740,064 - 16,755,978 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	14,111,728 - 14,127,278 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	15,091,251 - 15,107,052 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rab36	Rat	chromosome 22q11.2 deletion syndrome, distal		ISO	RGD:1347973	8554872	ClinVar Annotator: match by term: Chromosome 22q11.2 deletion syndrome, distal	ClinVar	PMID:25741868\|PMID:38177409
Rab36	Rat	DiGeorge syndrome		ISO	RGD:1347973	8554872	ClinVar Annotator: match by term: DiGeorge syndrome	ClinVar	PMID:32581362
Rab36	Rat	schizophrenia		ISO	RGD:1347973	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106\|PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rab36	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1623108	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAB36 mRNA	CTD	PMID:36331819
Rab36	Rat	17beta-estradiol	affects expression	ISO	RGD:1347973	6480464	Estradiol affects the expression of RAB36 mRNA	CTD	PMID:14699072
Rab36	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1347973	6480464	[Estradiol binds to ESR2 protein] which results in increased expression of RAB36 mRNA	CTD	PMID:20404318
Rab36	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1623108	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression more ...	CTD	PMID:25975270
Rab36	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of RAB36 mRNA	CTD	PMID:33387578
Rab36	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1623108	6480464	Tetrachlorodibenzodioxin affects the expression of RAB36 mRNA	CTD	PMID:26377647
Rab36	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Rab36	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1623108	6480464	bisphenol S affects the methylation of RAB36 gene	CTD	PMID:31683443
Rab36	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1623108	6480464	Fenretinide results in increased expression of RAB36 mRNA	CTD	PMID:28973697
Rab36	Rat	acrylamide	decreases expression	ISO	RGD:1347973	6480464	Acrylamide results in decreased expression of RAB36 mRNA	CTD	PMID:32763439
Rab36	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1347973	6480464	Aflatoxin B1 results in decreased methylation of RAB36 intron	CTD	PMID:30157460
Rab36	Rat	Aflatoxin B2 alpha	increases methylation	ISO	RGD:1347973	6480464	aflatoxin B2 results in increased methylation of RAB36 intron	CTD	PMID:30157460
Rab36	Rat	arsane	multiple interactions	ISO	RGD:1347973	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	arsenic atom	multiple interactions	ISO	RGD:1347973	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	atrazine	increases expression	EXP		6480464	Atrazine results in increased expression of RAB36 mRNA	CTD	PMID:36841081
Rab36	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1347973	6480464	Benzo(a)pyrene affects the methylation of RAB36 intron	CTD	PMID:30157460
Rab36	Rat	benzo[e]pyrene	increases methylation	ISO	RGD:1347973	6480464	benzo(e)pyrene results in increased methylation of RAB36 intron	CTD	PMID:30157460
Rab36	Rat	beta-lapachone	increases expression	ISO	RGD:1347973	6480464	beta-lapachone results in increased expression of RAB36 mRNA	CTD	PMID:38218311
Rab36	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RAB36 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Rab36	Rat	bisphenol A	decreases expression	ISO	RGD:1623108	6480464	bisphenol A results in decreased expression of RAB36 mRNA	CTD	PMID:32156529
Rab36	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Rab36	Rat	bisphenol A	increases expression	ISO	RGD:1347973	6480464	bisphenol A results in increased expression of RAB36 mRNA	CTD	PMID:29275510
Rab36	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Rab36	Rat	butanal	decreases expression	ISO	RGD:1347973	6480464	butyraldehyde results in decreased expression of RAB36 mRNA	CTD	PMID:26079696
Rab36	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of RAB36 promoter	CTD	PMID:22457795
Rab36	Rat	cadmium dichloride	decreases expression	ISO	RGD:1347973	6480464	Cadmium Chloride results in decreased expression of RAB36 mRNA	CTD	PMID:38568856
Rab36	Rat	carbon nanotube	decreases expression	ISO	RGD:1623108	6480464	Nanotubes, Carbon results in decreased expression of RAB36 mRNA	CTD	PMID:25554681
Rab36	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of RAB36 mRNA	CTD	PMID:26033743
Rab36	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of RAB36 mRNA	CTD	PMID:26033743
Rab36	Rat	DDE	increases expression	ISO	RGD:1347973	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of RAB36 mRNA	CTD	PMID:38568856
Rab36	Rat	diquat	decreases expression	ISO	RGD:1623108	6480464	Diquat results in decreased expression of RAB36 mRNA	CTD	PMID:36851058
Rab36	Rat	ethanol	affects expression	ISO	RGD:1623108	6480464	Ethanol affects the expression of RAB36 mRNA	CTD	PMID:30319688
Rab36	Rat	fipronil	decreases expression	EXP		6480464	fipronil results in decreased expression of RAB36 mRNA	CTD	PMID:34044035
Rab36	Rat	folic acid	decreases expression	ISO	RGD:1623108	6480464	Folic Acid results in decreased expression of RAB36 mRNA	CTD	PMID:25629700
Rab36	Rat	fonofos	increases methylation	ISO	RGD:1347973	6480464	Fonofos results in increased methylation of RAB36 promoter	CTD	PMID:22847954
Rab36	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of RAB36 mRNA	CTD	PMID:33387578
Rab36	Rat	iron dichloride	decreases expression	ISO	RGD:1347973	6480464	ferrous chloride results in decreased expression of RAB36 mRNA	CTD	PMID:35984750
Rab36	Rat	manganese atom	multiple interactions	ISO	RGD:1347973	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	manganese(0)	multiple interactions	ISO	RGD:1347973	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1347973	6480464	[manganese chloride results in increased abundance of Manganese] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	methapyrilene	increases methylation	ISO	RGD:1347973	6480464	Methapyrilene results in increased methylation of RAB36 intron	CTD	PMID:30157460
Rab36	Rat	paracetamol	affects expression	ISO	RGD:1623108	6480464	Acetaminophen affects the expression of RAB36 mRNA	CTD	PMID:17562736
Rab36	Rat	parathion	increases methylation	ISO	RGD:1347973	6480464	Parathion results in increased methylation of RAB36 promoter	CTD	PMID:22847954
Rab36	Rat	PCB138	decreases expression	EXP		6480464	2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of RAB36 mRNA	CTD	PMID:23829299
Rab36	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1623108	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAB36 mRNA	CTD	PMID:36331819
Rab36	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	RGD:1623108	6480464	Pregnenolone Carbonitrile results in decreased expression of RAB36 mRNA	CTD	PMID:28903501
Rab36	Rat	resveratrol	multiple interactions	ISO	RGD:1347973	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of RAB36 mRNA	CTD	PMID:23557933
Rab36	Rat	rotenone	decreases expression	ISO	RGD:1347973	6480464	Rotenone results in decreased expression of RAB36 mRNA	CTD	PMID:29955902
Rab36	Rat	sodium arsenite	decreases expression	ISO	RGD:1347973	6480464	sodium arsenite results in decreased expression of RAB36 mRNA	CTD	PMID:38568856
Rab36	Rat	sodium arsenite	multiple interactions	ISO	RGD:1347973	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RAB36 more ...	CTD	PMID:39836092
Rab36	Rat	terbufos	increases methylation	ISO	RGD:1347973	6480464	terbufos results in increased methylation of RAB36 promoter	CTD	PMID:22847954
Rab36	Rat	thiram	decreases expression	ISO	RGD:1347973	6480464	Thiram results in decreased expression of RAB36 mRNA	CTD	PMID:38568856
Rab36	Rat	titanium dioxide	decreases expression	ISO	RGD:1623108	6480464	titanium dioxide results in decreased expression of RAB36 mRNA	CTD	PMID:29264374
Rab36	Rat	triphenyl phosphate	affects expression	ISO	RGD:1347973	6480464	triphenyl phosphate affects the expression of RAB36 mRNA	CTD	PMID:37042841
Rab36	Rat	valproic acid	increases expression	ISO	RGD:1347973	6480464	Valproic Acid results in increased expression of RAB36 mRNA	CTD	PMID:23179753
Rab36	Rat	valproic acid	affects expression	ISO	RGD:1347973	6480464	Valproic Acid affects the expression of RAB36 mRNA	CTD	PMID:25979313
Rab36	Rat	valproic acid	affects splicing	EXP		6480464	Valproic Acid affects the splicing of RAB36 mRNA	CTD	PMID:29427782
Rab36	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of RAB36 gene	CTD	PMID:31682807

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rab36	Rat	vesicle-mediated transport	involved_in	IBA	FB:FBgn0025382\|FB:FBgn0031090\|MGI:104606\|MGI:1861441\|MGI:3045302\|PANTHER:PTN002785905\|RGD:620114\|TAIR:locus:2205603\|UniProtKB:O00194\|UniProtKB:P51159\|UniProtKB:Q15286\|UniProtKB:Q9BSW2\|UniProtKB:Q9BZG1\|WB:WBGene00000089\|WB:WBGene00004284	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rab36	Rat	GTP binding	enables	IBA	MGI:1861441\|MGI:1931295\|PANTHER:PTN002785905\|UniProtKB:O00194\|UniProtKB:P51159\|UniProtKB:Q15286\|UniProtKB:Q8IZ41	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rab36	Rat	GTP binding	enables	IEA	InterPro:IPR001806\|InterPro:IPR005225	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rab36	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rab36	Rat	GTPase activity	enables	IBA	MGI:104606\|MGI:1861441\|MGI:1931295\|PANTHER:PTN002785905\|UniProtKB:Q15286\|UniProtKB:Q9BSW2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rab36	Rat	GTPase activity	enables	IEA	InterPro:IPR001806	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rab36	Rat	protein binding	enables	ISO	RGD:1347973	1624291	UniProtKB:O75031 PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Rab36
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	13,606,086 - 13,624,208 (-)	NCBI		GRCr8
mRatBN7.2	20	13,606,700 - 13,624,304 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	13,608,136 - 13,624,170 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	14,314,630 - 14,330,407 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	13,675,463 - 13,691,240 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	14,148,058 - 14,163,835 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	14,557,485 - 14,573,939 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	14,557,740 - 14,573,519 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	16,740,064 - 16,755,978 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	14,111,728 - 14,127,278 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	15,091,251 - 15,107,052 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

RAB36
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	23,145,324 - 23,169,280 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	23,145,366 - 23,165,663 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	23,487,511 - 23,507,850 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	21,817,513 - 21,836,531 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	21,812,066 - 21,831,085	NCBI
Celera	22	7,302,063 - 7,321,070 (+)	NCBI		Celera
Cytogenetic Map	22	q11.23	NCBI
HuRef	22	6,455,237 - 6,474,245 (+)	NCBI		HuRef
CHM1_1	22	23,499,786 - 23,518,792 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	23,568,177 - 23,592,144 (+)	NCBI		T2T-CHM13v2.0

Rab36
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	74,872,727 - 74,890,580 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	74,872,890 - 74,890,580 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	75,036,895 - 75,054,748 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	75,037,058 - 75,054,748 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	74,499,834 - 74,516,845 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	74,480,805 - 74,497,816 (+)	NCBI		MGSCv36	mm8
Celera	10	76,084,913 - 76,101,889 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	38.49	NCBI

Rab36
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	7,575,875 - 7,587,972 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	7,574,376 - 7,590,024 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAB36
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	32,976,440 - 33,003,010 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	35,085,772 - 35,106,142 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	22	21,768,203 - 21,785,755 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	21,768,203 - 21,785,755 (+)	Ensembl	panpan1.1		panPan2

RAB36
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	27,831,256 - 27,845,918 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	27,831,196 - 27,844,670 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	26,906,969 - 26,921,643 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	29,235,182 - 29,249,889 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	29,235,189 - 29,245,936 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	27,318,531 - 27,333,235 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	26,936,027 - 26,950,729 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	27,925,302 - 27,940,012 (+)	NCBI		UU_Cfam_GSD_1.0

Rab36
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	142,475,251 - 142,491,662 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936619	264,252 - 276,529 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936619	262,356 - 278,682 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB36
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	49,188,360 - 49,204,656 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	49,186,282 - 49,202,334 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	52,612,204 - 52,625,420 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB36
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	2,720,771 - 2,737,989 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	2,718,883 - 2,737,602 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666085	4,389,296 - 4,405,578 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab36
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	9,506,138 - 9,519,176 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	9,504,525 - 9,521,315 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rab36
200 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	284
Count of miRNA genes:	163
Interacting mature miRNAs:	187
Transcripts:	ENSRNOT00000001772
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

RH138065

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	13,621,350 - 13,621,523 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	14,570,960 - 14,571,132	NCBI	Rnor6.0
Rnor_5.0	20	16,752,997 - 16,753,169	UniSTS	Rnor5.0
RGSC_v3.4	20	14,124,719 - 14,124,891	UniSTS	RGSC3.4
Celera	20	15,104,493 - 15,104,665	UniSTS
Cytogenetic Map	20	p12	UniSTS

AU049161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	13,624,960 - 13,625,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	14,574,570 - 14,574,700	NCBI	Rnor6.0
Rnor_5.0	20	16,756,607 - 16,756,737	UniSTS	Rnor5.0
RGSC_v3.4	20	14,128,329 - 14,128,459	UniSTS	RGSC3.4
Celera	20	15,108,103 - 15,108,233	UniSTS
Cytogenetic Map	20	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	49	113	85	84	53	23	53	6	209	95	93	45	60	31


RefSeq Transcripts	NM_001109589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001772 ⟹ ENSRNOP00000001772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	13,608,136 - 13,619,185 (-)	Ensembl
Rnor_6.0 Ensembl	20	14,557,740 - 14,573,519 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095296 ⟹ ENSRNOP00000078135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	13,608,136 - 13,624,170 (-)	Ensembl

RefSeq Acc Id:

NM_001109589 ⟹ NP_001103059

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	13,606,086 - 13,623,513 (-)	NCBI
mRatBN7.2	20	13,606,700 - 13,624,128 (-)	NCBI
Rnor_6.0	20	14,557,739 - 14,573,519 (-)	NCBI
Rnor_5.0	20	16,740,064 - 16,755,978 (-)	NCBI
RGSC_v3.4	20	14,111,728 - 14,127,278 (-)	RGD
Celera	20	15,091,251 - 15,107,052 (-)	RGD

Sequence:

show sequence

GGTGATTTGCAGCGGCCTGCGCGCCAGAACCTGGTCTTTGCAGCTTTGAACACTGGAAGAATGAGGTCCTCTTGGACCCCTCTGGGGCCCCCTGTGAGCCAGGATCGAATCATCACCAGCTTCCCTAA
GTGGTACACGCCGGATGCCTGCCTGCAGCTCAAGGAGCACTTCCACAGCCAGGTCAGCACAGCCTGCCAGCACAGGAACACGGGCACTGCTGGGCTCAGACTCTCCAAGGTGGTGGTAGTTGGTGATC
TCTACGTGGGAAAGACTAGCCTCATTCACAGGTTATGCAAGAATGTTTTCGACCGGGATTACAAGGCCACGATTGGTGTAGACTTTGAAATCGAGCGCTTTGAGATCGCAGGGATTCCCTACAGCCTC
CAGATCTGGGACACAGCCGGACAGGAAAAGTTCAAGTGCATTGCGTCTGCCTACTACCGCGGTGCCCAGGTGATCATCACAGCCTTTGACCTCACCGACGTGCAGACTCTGGAGCATACCAAGCAGTG
GCTGCAGGATGTGCTGAGGGAGAATGAGGCAGGTTCTTGCTTCATCTTCCTCGTGGGAACCAAGAAGGATCTCCTGTCAGGGGCAGCGTGCGAGCAGGCGGAAGCAGAAGCTGTGCATCTGGCCAATG
AGATGCAGGCAGAGTACTGGTCTGTGTCGGCCAAGACGGGAGAGAACGTGAAGGCATTCTTCAGCCGAGTCGCCGCCCTAGCCTTTGAACAGTCTGTACTTCAGGACCTAGAGAAGAGGCCCAGCACC
CAGTCCCAGGTCGGAGATGGAGATGGAGACCTAATACGAATAGAGGTACCGAAGACGCAGGAGAACAAAAGGCCACCTGGCCTGGGTTGCTGTTAACTGAGGCCAGCATCAGAGCCATCACAGGGTGT
GACATAGAGCCCAAGCTCTTCAGTGGACATGCCTTAAAGCTGGAGAAGCCCTGTGTCTCCAGAGCCCAGCCATTTCTCTTTAGCCGGTCAGCAGCCACTGGCTGCTGAAACCCCATACTGCCTGGCTG
GTTGATGGGCACCAGGGTGAGCCTTCTCTTTAGGGTCTTCAGACTGTCACCGTGTTCTTAAGAGGCTCCAAGACTGCGAACTCGGGGCACCTCGGGCTAGCCCACGTCCCTTACCCAATTATACCAAT
AACTGTGGGGCCCTTTCGTGTGGATCCTCTGGGATCTCCATGTTCCAAGCACGGAGACTTGTCAGAGTGGGCAAGTAAAATTAACCTGCCATCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001415699 ⟹ NP_001402628

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	13,606,086 - 13,623,513 (-)	NCBI
mRatBN7.2	20	13,606,700 - 13,624,128 (-)	NCBI

RefSeq Acc Id:

XM_063279528 ⟹ XP_063135598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	13,606,086 - 13,624,208 (-)	NCBI

RefSeq Acc Id:

XM_063279529 ⟹ XP_063135599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	13,606,086 - 13,623,378 (-)	NCBI

RefSeq Acc Id:

XR_010060757

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	13,609,402 - 13,624,208 (-)	NCBI


Protein RefSeqs	NP_001103059	(Get FASTA)	NCBI Sequence Viewer
	NP_001402628	(Get FASTA)	NCBI Sequence Viewer
	XP_063135598	(Get FASTA)	NCBI Sequence Viewer
	XP_063135599	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67029	(Get FASTA)	NCBI Sequence Viewer
	EDL97234	(Get FASTA)	NCBI Sequence Viewer
	EDL97235	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001772.6
	ENSRNOP00000078135
	ENSRNOP00000078135.1

RefSeq Acc Id:

NP_001103059 ⟸ NM_001109589

- UniProtKB:

B2RZ53 (UniProtKB/TrEMBL), F7F2S0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRSSWTPLGPPVSQDRIITSFPKWYTPDACLQLKEHFHSQVSTACQHRNTGTAGLRLSKVVVVGDLYVGKTSLIHRLCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYR
GAQVIITAFDLTDVQTLEHTKQWLQDVLRENEAGSCFIFLVGTKKDLLSGAACEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLEKRPSTQSQVGDGDGDLIRIEVPKTQ
ENKRPPGLGCC

hide sequence

Ensembl Acc Id:

ENSRNOP00000001772 ⟸ ENSRNOT00000001772

Ensembl Acc Id:

ENSRNOP00000078135 ⟸ ENSRNOT00000095296

RefSeq Acc Id:	NP_001402628 ⟸ NM_001415699
- UniProtKB:	F7F2S0 (UniProtKB/TrEMBL), B2RZ53 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063135598 ⟸ XM_063279528
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5YC69 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ53-F1-model_v2	AlphaFold	B2RZ53	1-267	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701545

Promoter ID:

EPDNEW_R12069

Type:

single initiation site

Name:

Rab36_1

Description:

RAB36, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	14,573,527 - 14,573,587	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-4102	BioCyc
Ensembl Genes	ENSRNOG00000001311	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001772.7	UniProtKB/TrEMBL
	ENSRNOT00000095296	ENTREZGENE
	ENSRNOT00000095296.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8368465	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Rab	UniProtKB/TrEMBL
	Ras_GTPase	UniProtKB/TrEMBL
	Small_GTP_bd	UniProtKB/TrEMBL
KEGG Report	rno:690407	UniProtKB/TrEMBL
MGC_CLONE	MGC:189269	IMAGE-MGC_LOAD
NCBI Gene	690407	ENTREZGENE
PANTHER	RAS-RELATED PROTEIN RAB	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PhenoGen	Rab36	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001311	RatGTEx
SMART	RAB	UniProtKB/TrEMBL
	RAN	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I5YC69	ENTREZGENE, UniProtKB/TrEMBL
	B2RZ53	ENTREZGENE, UniProtKB/TrEMBL
	F7F2S0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Rab36	RAB36, member RAS oncogene family	LOC690407	similar to RAB36, member RAS oncogene family	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC690407	similar to RAB36, member RAS oncogene family			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar