Advanced Search (OLGA)

Gene: Siah3 (siah E3 ubiquitin protein ligase family member 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Siah3

Name:

siah E3 ubiquitin protein ligase family member 3

RGD ID:

1592168

Description:

Predicted to enable ubiquitin conjugating enzyme binding activity and ubiquitin protein ligase activity. Predicted to be involved in negative regulation of protein targeting to mitochondrion; proteasome-mediated ubiquitin-dependent protein catabolic process; and regulation of protein stability. Predicted to be located in mitochondrion and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human SIAH3 (siah E3 ubiquitin protein ligase family member 3); INTERACTS WITH bisphenol A; paracetamol; trichloroethene.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

LOC692004; seven in absentia homolog 3; seven in absentia homolog 3 (Drosophila); seven in absentia homolog 3-like; similar to Ubiquitin ligase Siah2 (Seven in absentia homolog 2-like) (Siah-2)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	57,180,245 - 57,247,608 (+)	NCBI		GRCr8
mRatBN7.2	15	50,770,839 - 50,838,213 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	50,770,871 - 50,834,487 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	54,920,651 - 54,983,939 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	56,038,968 - 56,102,263 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	52,863,924 - 52,928,634 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	57,505,449 - 57,568,743 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	57,505,449 - 57,568,743 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	61,215,305 - 61,278,376 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	56,320,672 - 56,387,549 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	50,401,567 - 50,465,060 (+)	NCBI		Celera
Cytogenetic Map	15	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Siah3	Rat	aflatoxin B1	decreases methylation	ISO	SIAH3 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of SIAH3 intron	CTD	PMID:30157460
Siah3	Rat	Aflatoxin B2 alpha	increases methylation	ISO	SIAH3 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of SIAH3 intron	CTD	PMID:30157460
Siah3	Rat	benzo[a]pyrene	increases methylation	ISO	SIAH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SIAH3 3' UTR	CTD	PMID:27901495
Siah3	Rat	benzo[a]pyrene	decreases methylation	ISO	SIAH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of SIAH3 5' UTR and Benzo(a)pyrene results in decreased methylation of SIAH3 exon	CTD	PMID:27901495
Siah3	Rat	benzo[a]pyrene	affects methylation	ISO	SIAH3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SIAH3 promoter	CTD	PMID:27901495
Siah3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SIAH3 mRNA	CTD	PMID:30816183 more ...
Siah3	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SIAH3 gene	CTD	PMID:28505145
Siah3	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of SIAH3 mRNA	CTD	PMID:33387578
Siah3	Rat	perfluorohexanesulfonic acid	increases expression	ISO	SIAH3 (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in increased expression of SIAH3 mRNA	CTD	PMID:25812627
Siah3	Rat	perfluorononanoic acid	increases expression	ISO	SIAH3 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in increased expression of SIAH3 mRNA	CTD	PMID:25812627
Siah3	Rat	sodium arsenite	increases expression	ISO	SIAH3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of SIAH3 mRNA	CTD	PMID:34032870
Siah3	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of SIAH3 mRNA	CTD	PMID:33387578
Siah3	Rat	valproic acid	increases expression	ISO	SIAH3 (Homo sapiens)	6480464	Valproic Acid results in increased expression of SIAH3 mRNA	CTD	PMID:23179753
Siah3	Rat	valproic acid	affects expression	ISO	SIAH3 (Homo sapiens)	6480464	Valproic Acid affects the expression of SIAH3 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Siah3	Rat	negative regulation of protein targeting to mitochondrion	involved_in	ISO	SIAH3 (Homo sapiens)	1624291	PMID:24270810	RGD	PMID:24270810
Siah3	Rat	negative regulation of protein targeting to mitochondrion	involved_in	IEA	UniProtKB:Q8IW03 and ensembl:ENSP00000383256	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Siah3	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	FB:FBgn0003410 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Siah3	Rat	protein ubiquitination	involved_in	IEA	UniPathway:UPA00143	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Siah3	Rat	regulation of protein stability	involved_in	ISO	SIAH3 (Homo sapiens)	1624291	PMID:24270810	RGD	PMID:24270810
Siah3	Rat	regulation of protein stability	involved_in	IEA	UniProtKB:Q8IW03 and ensembl:ENSP00000383256	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Siah3	Rat	ubiquitin-dependent protein catabolic process	involved_in	IEA	InterPro:IPR004162 and InterPro:IPR018121	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Siah3	Rat	cytoplasm	located_in	IEA	InterPro:IPR018121	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Siah3	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0003410 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Siah3	Rat	mitochondrion	located_in	IEA	UniProtKB:Q8IW03 and ensembl:ENSP00000383256	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Siah3	Rat	mitochondrion	located_in	ISO	SIAH3 (Homo sapiens)	1624291	PMID:24270810	RGD	GO_REF:0000052 and PMID:24270810
Siah3	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q8IW03 and ensembl:ENSP00000383256	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Siah3	Rat	nucleoplasm	located_in	ISO	SIAH3 (Homo sapiens)	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Siah3	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Siah3	Rat	protein binding	enables	ISO	SIAH3 (Homo sapiens)	1624291	UniProtKB:Q3LI66 and PMID:32296183	RGD	PMID:32296183
Siah3	Rat	ubiquitin conjugating enzyme binding	enables	IBA	PANTHER:PTN000817023 and Siah2 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Siah3	Rat	ubiquitin protein ligase activity	enables	IBA	FB:FBgn0003410 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Siah3	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:24270810	PMID:36307912

Siah3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	57,180,245 - 57,247,608 (+)	NCBI		GRCr8
mRatBN7.2	15	50,770,839 - 50,838,213 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	50,770,871 - 50,834,487 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	54,920,651 - 54,983,939 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	56,038,968 - 56,102,263 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	52,863,924 - 52,928,634 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	57,505,449 - 57,568,743 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	57,505,449 - 57,568,743 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	61,215,305 - 61,278,376 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	56,320,672 - 56,387,549 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	50,401,567 - 50,465,060 (+)	NCBI		Celera
Cytogenetic Map	15	q11	NCBI

SIAH3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	45,777,242 - 45,851,753 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	45,777,242 - 45,851,753 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	46,351,377 - 46,425,888 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	45,252,406 - 45,323,847 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	27,409,074 - 27,480,538 (-)	NCBI		Celera
Cytogenetic Map	13	q14.13	NCBI
HuRef	13	27,151,095 - 27,222,572 (-)	NCBI		HuRef
CHM1_1	13	46,323,339 - 46,394,823 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	44,998,546 - 45,073,093 (-)	NCBI		T2T-CHM13v2.0

Siah3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	75,693,372 - 75,767,148 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	75,693,422 - 75,767,148 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	75,455,982 - 75,526,141 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	75,455,982 - 75,529,708 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	75,855,789 - 75,925,948 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	74,190,132 - 74,260,462 (+)	NCBI		MGSCv36	mm8
Celera	14	72,957,859 - 73,027,877 (+)	NCBI		Celera
Cytogenetic Map	14	D3	NCBI
cM Map	14	40.08	NCBI

Siah3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955518	3,472,425 - 3,539,115 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955518	3,473,120 - 3,539,086 (-)	NCBI	ChiLan1.0	ChiLan1.0

SIAH3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	45,539,882 - 45,612,512 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	36,593,953 - 36,666,560 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	27,180,382 - 27,255,005 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SIAH3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	5,320,083 - 5,390,389 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	5,320,249 - 5,386,508 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	5,309,191 - 5,379,473 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	5,438,371 - 5,508,337 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	5,438,394 - 5,510,519 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	5,219,846 - 5,290,132 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	5,283,539 - 5,353,477 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	5,288,339 - 5,358,617 (+)	NCBI		UU_Cfam_GSD_1.0

Siah3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	155,915,563 - 155,984,592 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936857	339,615 - 406,806 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936857	341,879 - 406,806 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SIAH3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	21,501,492 - 21,562,077 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	21,500,605 - 21,562,301 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	22,075,723 - 22,078,885 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SIAH3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	23,840,947 - 23,909,954 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	23,841,195 - 23,908,631 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666057	20,108,328 - 20,176,080 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Siah3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624748	9,136,650 - 9,231,109 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624748	9,136,665 - 9,234,392 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Siah3
459 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	77
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000064945
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
724545	Niddm54	Non-insulin dependent diabetes mellitus QTL 54		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	50794494	73699215	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
2293686	Bmd36	Bone mineral density QTL 36	7.4	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	15	33611058	71477291	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	34054139	79054139	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
2293691	Bmd37	Bone mineral density QTL 37	6.6	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	15	33611058	71477291	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat

D15Rat19

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	57,203,895 - 57,204,051 (+)	Marker Load Pipeline
mRatBN7.2	15	50,794,494 - 50,794,652 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	57,528,970 - 57,529,125	NCBI	Rnor6.0
Rnor_5.0	15	61,238,603 - 61,238,758	UniSTS	Rnor5.0
RGSC_v3.4	15	56,346,569 - 56,346,725	RGD	RGSC3.4
RGSC_v3.4	15	56,346,570 - 56,346,725	UniSTS	RGSC3.4
RGSC_v3.1	15	56,362,349 - 56,362,505	RGD
Celera	15	50,425,266 - 50,425,421	UniSTS
SHRSP x BN Map	15	34.6299	UniSTS
SHRSP x BN Map	15	34.6299	RGD
FHH x ACI Map	15	47.47	RGD
Cytogenetic Map	15	q11	UniSTS

D15Rat122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	50,782,130 - 50,782,301 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	57,516,608 - 57,516,778	NCBI	Rnor6.0
Rnor_5.0	15	61,226,241 - 61,226,411	UniSTS	Rnor5.0
RGSC_v3.4	15	56,334,208 - 56,334,379	RGD	RGSC3.4
RGSC_v3.4	15	56,334,209 - 56,334,379	UniSTS	RGSC3.4
RGSC_v3.1	15	56,349,968 - 56,350,359	RGD
Celera	15	50,412,906 - 50,413,076	UniSTS
SHRSP x BN Map	15	34.6299	RGD
SHRSP x BN Map	15	34.6299	UniSTS
Cytogenetic Map	15	q11	UniSTS

D15Rat146

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	57,229,151 - 57,229,353 (+)	Marker Load Pipeline
mRatBN7.2	15	50,819,755 - 50,819,957 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	57,554,226 - 57,554,427	NCBI	Rnor6.0
Rnor_5.0	15	61,263,859 - 61,264,060	UniSTS	Rnor5.0
RGSC_v3.4	15	56,371,825 - 56,372,027	RGD	RGSC3.4
RGSC_v3.4	15	56,371,826 - 56,372,027	UniSTS	RGSC3.4
RGSC_v3.1	15	56,387,605 - 56,387,807	RGD
Celera	15	50,450,526 - 50,450,727	UniSTS
SHRSP x BN Map	15	34.6299	UniSTS
SHRSP x BN Map	15	34.6299	RGD
Cytogenetic Map	15	q11	UniSTS

D15Got60

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	57,213,414 - 57,213,608 (+)	Marker Load Pipeline
mRatBN7.2	15	50,804,015 - 50,804,211 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	57,538,489 - 57,538,682	NCBI	Rnor6.0
Rnor_5.0	15	61,248,122 - 61,248,315	UniSTS	Rnor5.0
RGSC_v3.4	15	56,356,088 - 56,356,282	RGD	RGSC3.4
RGSC_v3.4	15	56,356,089 - 56,356,282	UniSTS	RGSC3.4
RGSC_v3.1	15	56,371,868 - 56,372,062	RGD
Celera	15	50,434,785 - 50,434,978	UniSTS
RH 2.0 Map	15	370.8	RGD
Cytogenetic Map	15	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	3	36	113	41	30	13	9	13	6	115	65	93	29	57	17


RefSeq Transcripts	NM_001191118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064945 ⟹ ENSRNOP00000059053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	50,770,871 - 50,834,487 (+)	Ensembl
Rnor_6.0 Ensembl	15	57,505,449 - 57,568,743 (+)	Ensembl

RefSeq Acc Id:

NM_001191118 ⟹ NP_001178047

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	57,180,245 - 57,247,608 (+)	NCBI
mRatBN7.2	15	50,770,839 - 50,838,213 (+)	NCBI
Rnor_6.0	15	57,505,449 - 57,568,743 (+)	NCBI
Rnor_5.0	15	61,215,305 - 61,278,376 (+)	NCBI
Celera	15	50,401,567 - 50,465,060 (+)	NCBI

Sequence:

show sequence

ATGCTTTTCTTTACACAGTGCTTTGGGGCTGTGTTGGATCTCATTCACCTCCGGTTTCAGCACTACAAGGCTAAACGGGTTTTCTCTGCTGCTGGGCAACTTGTCTGTGTGGTCAACCCCACCAACAA
TCTAAAGTATGTGTCTAGTAGACGGGCCATCACTCAGAACTCTGCTGAGCAAGGTAGCTTCCACCAGCACCATCTTCCCCACCACCATCGCCACCACTGTCACCACAACCACCTGTATCAGCATGCCC
GTCCCCACCACCTCCACCACCAGGAGCCCGGACTGCACAGCACTCAGATGACACCCTGCATTTGCCCCCTGTTCTCCTGCCAATGGGAAGGGCACCTGGAGGTGGTGGTCCCTCACCTGCGGCAAATC
CACAGGATCGACATCCTGCACGGGGCGGAGATAGTGTTCCTGGCCACGGACATGCACCTCCCCGCGCCAGCCGATTGGATCATCATGCACTCCTGCCTCGGCCATCACTTCCTGCTGGTGCTCAGGAA
ACAGGAACGACATGAAGGGCACCCTCAGTTCTTTGCTACCATGATGCTGATTGGGACCCCCACACAGGCCGACTGCTTCACCTATCGCCTGGAGCTCAACAGAAACCACAGGCGTCTCAAATGGGAGG
CCACCCCGAGATCCGTCCTGGAGTGTGTGGACTCAGTCATCACCGACGGGGACTGCCTGGTTCTCAACACCTCACTGGCCCAGCTTTTCTCTGACAATGGCAGCCTCGCCATTGGAATCGCCATCACT
GAGACGGAGGTCAGAGCCAGGGATGCTGCTGAGATGTGA

hide sequence


Protein RefSeqs	NP_001178047	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059053.2
	ENSRNOP00000100657

RefSeq Acc Id:

NP_001178047 ⟸ NM_001191118

- UniProtKB:

F1M4M8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTNNLKYVSSRRAITQNSAEQGSFHQHHLPHHHRHHCHHNHLYQHARPHHLHHQEPGLHSTQMTPCICPLFSCQWEGHLEVVVPHLRQI
HRIDILHGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLAQLFSDNGSLAIGIAIT
ETEVRARDAAEM

hide sequence

Ensembl Acc Id:

ENSRNOP00000059053 ⟸ ENSRNOT00000064945

Protein Domains

Seven-in-absentia protein TRAF-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M4M8-F1-model_v2	AlphaFold	F1M4M8	1-268	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-13126	BioCyc
Ensembl Genes	ENSRNOG00000043061	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000082882	ENTREZGENE
Ensembl Transcript	ENSRNOT00000064945.3	UniProtKB/TrEMBL
	ENSRNOT00000158379	ENTREZGENE
Gene3D-CATH	Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2, Chain A	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	7-in-absentia-prot	UniProtKB/TrEMBL
	7-in-absentia-prot_TRAF-dom	UniProtKB/TrEMBL
	TRAF-like	UniProtKB/TrEMBL
KEGG Report	rno:692004	UniProtKB/TrEMBL
NCBI Gene	692004	ENTREZGENE
PANTHER	PTHR45877	UniProtKB/TrEMBL
	SEVEN IN ABSENTIA HOMOLOG 3	UniProtKB/TrEMBL
Pfam	Sina	UniProtKB/TrEMBL
PhenoGen	Siah3	PhenoGen
RatGTEx	ENSRNOG00000043061	RatGTEx
	ENSRNOG00000082882	RatGTEx
Superfamily-SCOP	TRAF domain-like	UniProtKB/TrEMBL
UniProt	F1M4M8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Siah3	siah E3 ubiquitin protein ligase family member 3	LOC100366198	seven in absentia homolog 3-like	Data merged from RGD:2324160	1643240	APPROVED
2012-10-16	Siah3	siah E3 ubiquitin protein ligase family member 3	Siah3	seven in absentia homolog 3 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-06	LOC100366198	seven in absentia homolog 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-04-23	Siah3	seven in absentia homolog 3 (Drosophila)	LOC692004	similar to Ubiquitin ligase Siah2 (Seven in absentia homolog 2-like) (Siah-2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC692004	similar to Ubiquitin ligase Siah2 (Seven in absentia homolog 2-like) (Siah-2)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message