Ttc19 (tetratricopeptide repeat domain 19)

Advanced Search (OLGA)

Gene: Ttc19 (tetratricopeptide repeat domain 19) Rattus norvegicus

Analyze

Symbol:

Ttc19

Name:

tetratricopeptide repeat domain 19

RGD ID:

1582808

Description:

Predicted to be involved in mitochondrial respiratory chain complex III assembly. Predicted to be located in mitochondrion. Predicted to be active in mitochondrial inner membrane. Human ortholog(s) of this gene implicated in mitochondrial complex III deficiency nuclear type 2. Orthologous to human TTC19 (tetratricopeptide repeat domain 19); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC287389; LOC691506; RGD1311797; similar to RIKEN cDNA 2810460C24; similar to Tetratricopeptide repeat protein 19 (TPR repeat protein 19); tetratricopeptide repeat protein 19; tetratricopeptide repeat protein 19, mitochondrial; TPR repeat protein 19

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TTC19 (tetratricopeptide repeat domain 19)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Ttc19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ttc19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TTC19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TTC19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ttc19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TTC19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TTC19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ttc19 (tetratricopeptide repeat domain 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TTC19 (tetratricopeptide repeat domain 19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ttc19 (tetratricopeptide repeat domain 19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ttc19 (tetratricopeptide repeat domain 19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ddl-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Ttc19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ttc19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	47,469,043 - 47,496,923 (+)	NCBI		GRCr8
mRatBN7.2	10	46,969,723 - 46,997,607 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	46,969,727 - 46,997,789 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	51,673,517 - 51,701,553 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	51,164,067 - 51,192,104 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	46,667,475 - 46,695,511 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	48,599,321 - 48,627,374 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	48,599,321 - 48,627,374 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	48,387,826 - 48,415,743 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	48,450,922 - 48,479,028 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	46,215,636 - 46,243,767 (+)	NCBI		Celera
Cytogenetic Map	10	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

genetic disease (ISO)

infertility (ISO)

mitochondrial complex III deficiency nuclear type 1 (ISO)

mitochondrial complex III deficiency nuclear type 2 (ISO)

mitochondrial metabolism disease (ISO)

nervous system disease (ISO)

neurodegenerative disease (ISO)

Neurologic Gait Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

benzene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cyclosporin A (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

ethanol (ISO)

fenthion (ISO)

fulvestrant (ISO)

gentamycin (EXP)

methidathion (ISO)

methimazole (EXP)

paracetamol (EXP,ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

tetraphene (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

troglitazone (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

mitochondrial respiratory chain complex III assembly (IBA,IEA,ISO,ISS)

Cellular Component

mitochondrial inner membrane (IBA,IEA,ISO,ISS)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:21278747

Genomics

Comparative Map Data

Ttc19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	47,469,043 - 47,496,923 (+)	NCBI		GRCr8
mRatBN7.2	10	46,969,723 - 46,997,607 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	46,969,727 - 46,997,789 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	51,673,517 - 51,701,553 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	51,164,067 - 51,192,104 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	46,667,475 - 46,695,511 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	48,599,321 - 48,627,374 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	48,599,321 - 48,627,374 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	48,387,826 - 48,415,743 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	48,450,922 - 48,479,028 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	46,215,636 - 46,243,767 (+)	NCBI		Celera
Cytogenetic Map	10	q23	NCBI

TTC19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	15,999,824 - 16,045,015 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	15,999,784 - 16,045,015 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	15,903,138 - 15,932,718 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	15,843,507 - 15,872,821 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	15,843,506 - 15,872,821	NCBI
Celera	17	15,805,789 - 15,835,101 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI
HuRef	17	15,769,742 - 15,799,765 (+)	NCBI		HuRef
CHM1_1	17	15,911,980 - 15,942,549 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	15,902,040 - 15,947,641 (+)	NCBI		T2T-CHM13v2.0

Ttc19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	62,172,256 - 62,208,611 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	62,172,299 - 62,219,277 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	62,281,429 - 62,331,879 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	62,281,473 - 62,328,451 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	62,094,975 - 62,129,943 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	62,097,675 - 62,131,443 (+)	NCBI		MGSCv36	mm8
Celera	11	69,200,414 - 69,235,362 (+)	NCBI		Celera
Cytogenetic Map	11	B2	NCBI
cM Map	11	38.02	NCBI

Ttc19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	1,381,625 - 1,405,014 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	1,381,105 - 1,405,509 (+)	NCBI	ChiLan1.0	ChiLan1.0

TTC19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	56,608,966 - 56,638,593 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	61,420,588 - 61,449,830 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	34,902,211 - 34,931,963 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

TTC19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	39,825,526 - 39,868,002 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	39,839,889 - 39,908,515 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	39,985,469 - 40,014,326 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	39,948,928 - 39,977,795 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	39,948,932 - 40,018,382 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	39,921,180 - 39,950,035 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	39,866,440 - 39,895,303 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	40,057,720 - 40,086,571 (-)	NCBI		UU_Cfam_GSD_1.0

Ttc19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	59,245,246 - 59,288,687 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936821	540,155 - 567,258 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936821	524,183 - 566,953 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TTC19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	59,393,224 - 59,418,995 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	59,393,217 - 59,418,821 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	62,477,277 - 62,493,181 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TTC19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	15,632,017 - 15,662,857 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666059	5,298,505 - 5,328,623 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ttc19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624877	4,381,368 - 4,404,083 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624877	4,380,164 - 4,404,104 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ttc19
176 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	155
Count of miRNA genes:	110
Interacting mature miRNAs:	135
Transcripts:	ENSRNOT00000057777
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH130301

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	46,971,895 - 46,972,107 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	48,601,490 - 48,601,701	NCBI	Rnor6.0
Rnor_5.0	10	48,389,995 - 48,390,206	UniSTS	Rnor5.0
RGSC_v3.4	10	48,453,091 - 48,453,302	UniSTS	RGSC3.4
Celera	10	46,217,805 - 46,218,016	UniSTS
RH 3.4 Map	10	540.5	UniSTS
Cytogenetic Map	10	q23	UniSTS

AI227962

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	46,997,397 - 46,997,571 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	48,626,983 - 48,627,156	NCBI	Rnor6.0
Rnor_5.0	10	48,415,352 - 48,415,525	UniSTS	Rnor5.0
RGSC_v3.4	10	48,478,637 - 48,478,810	UniSTS	RGSC3.4
Celera	10	46,243,376 - 46,243,549	UniSTS
RH 3.4 Map	10	545.3	UniSTS
Cytogenetic Map	10	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057777 ⟹ ENSRNOP00000054591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	46,969,727 - 46,997,789 (+)	Ensembl
Rnor_6.0 Ensembl	10	48,599,321 - 48,627,374 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112760 ⟹ ENSRNOP00000083047

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	46,969,727 - 46,997,789 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118989 ⟹ ENSRNOP00000091692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	46,969,727 - 46,997,789 (+)	Ensembl

RefSeq Acc Id:

NM_001109644 ⟹ NP_001103114

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,469,043 - 47,496,923 (+)	NCBI
mRatBN7.2	10	46,969,723 - 46,997,607 (+)	NCBI
Rnor_6.0	10	48,599,321 - 48,627,374 (+)	NCBI
Rnor_5.0	10	48,387,826 - 48,415,743 (+)	NCBI
RGSC_v3.4	10	48,450,922 - 48,479,028 (+)	RGD
Celera	10	46,215,636 - 46,243,767 (+)	RGD

Sequence:

show sequence

CAGCCGCGGCTAGTGGAGCTGTGAGGACGCGTCGGCATGTTCCGGCTGCTTCGCTGGCGTCTGG
GTCGAACCCTGCTGCGGGCCGCGGGCCGGCGGTGCGGGGGCTGTACTGCGCGCCTACTGCCGGA
GCGGGCCGGTGACGCGGGTCCGGGCGCGGAGCGGCTGCGGACCCGAGGCGCGCCGGCGCGGGGG
CACCGAGTGCTGCCGCTGTTGGCAGCGCTCGCCTGGTTCTCGCGAACCGCGGCGGCAGAGGAGC
AGCCGGGAGAGGACGCGACAGACGAGGCGGAGGCAGAGATCATCCAGCTGCTGAAGCGAGCCAA
GTTGAGCATCATGAAAGATGAGCCAGAAGCAGCCGAGCTGATTTTGCATGACGCTCTTCGCCTT
GCGTATGAGAGTGACAACAAGAAGGCCATCACGTACACTTATGACTTGGCAGAACAACTTTTTA
AAGCTACAATGAGCTACCTGCTTGGAGGAGGCATGAAGCAGGAAGACAATGCGATAGTTGAAAT
CTCTCTGAAACTGGCCAACATCTACGCTGCTCAGAATAAACAGGAGTTTGCCCTGGCTGGCTAT
GAATTCTGCATTTCAACTCTAGAGGGGAAAATTGAAAGAGAAAAGGAATTAGCAGAAGATATTA
TGTCAGAAGAAAGAGCCAATACTTACCTCCTCCTTGGCATGTGCTTAGACTCTTGTGCACGCTA
CCTGCTATTCTCCAAGCAGCTGTCACAGGCACAAAGGATGTATGAAAAAGCCCTGCAGATTTGT
CAAGAAATACAAGGAGAAAGACACCCACAGACCATTGTGCTGATGAGTGACTTGGCTACTGCTC
TGGATGCGCAGGGCCACTTTGATGATGCCTACATTTATATGCAGAGGGCGTCAGATCTGGCAAG
GGAGATAAATCACCCTGAGCTGCACATGGTGCTCAGCAATCTGGCTGCCATCTTGATACACAGA
GAACGATACACACAAGCAAAGGAGATCTACCAGGAAGCACTGAAGCAAGCAGAGCTGAAAAGAG
ATGAGTTTTCTGTTCAGCACATCAGGGAAGAATTGGCTGAGCTGTCAAGAAAAAGTAGACTTTT
GACTTAATGTTTGTTGTTAAGCTATAGAAGTTCATTTTGTCATAGAGAGGTAACCTCTGATAAC
CCAAAGGAGTAACTGTTCCTTCATTGTCTGGACCTCAATCGGTGGTGTAAATCATTGTTGAAAT
TCAACTTTCTTCAACTCAGCTTCGGTGAAGGACAAGTCCTATACACTGCCACTTCTGTTTCTAA
ATTTTACTTTGAGATGGGCATCTCTATGTGTAGGCTGGCCTGGAAATTGCTGTATGCTTGACGT
TGGCCTCCAACTTGGAGTACTCCTCCCTCAGCCTTGCAAGTGCCTGGCCCTACTTTTGTTTTTA
AAGGTGAAACAGCCTTTAGGTACAGTCCATGCTGGTCTGAGAAAACTGTAGACTACAGTTGGCC
AAGTTCCCCATGATATGGTCATTATACCTTCCATCAGATTTTGGTTCATGCTTAACTCTTCTCT
ATCTGTCTCTGCCAAACAAGTTACTTGTGTCATTACACATGAGGATTGTGGTGAGTTCTTACAC
ACTATTTTATTGAAGCATTGTGAGATTTAATGACTATGAAGGGCAATGATAATTCTAGTTGGCC
ACCATTAGGCAGCATTCACTTCTCAAATGGAAATGAGACACTTGAACTGTGTACCTGTTTATAT
ATAACTACTGGCAATGGTGGTGGCAGAAGGAAGGAAGCCCCCACCATGCCATCCGAGCACTAGG
GTTCCTTTATAAAGACAGGCACATACGGGAGTCAGGCACTGCTGCCAGCACCGGCGTACACCAA
GGTAACGTGCAACCCCTACCTGGATCCTGTTTAGCTCTTTTTTCTTTTGCAGTCTCTGTATTTA
CAGCTGTGAAGTGTGAAACCAATTAGATTGTCCGACGACTGTATCACTGCCTCAGAGTATATAA
ATACAAGATACATGGATGAATGCTTTTACCTTTGCAGTCTGACAAATGGTCTTTTGCCTAAGAA
AAAGACAGTTTTTCTGGGTGCCATGAAGGAAGCCTGGTGGTGGTAGCATGCCTGTGGAGGTGCG
TGGTGTGAGTAAGACTGCCAGTGGACTTTGGGTTCATGTGTTTATACAGGAGACAGTTTTCACA
ATAAACTGGAGACTATAC

hide sequence

RefSeq Acc Id:

NM_001415772 ⟹ NP_001402701

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,469,043 - 47,496,923 (+)	NCBI
mRatBN7.2	10	46,969,723 - 46,997,607 (+)	NCBI

RefSeq Acc Id:

XM_039086898 ⟹ XP_038942826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,469,083 - 47,491,603 (+)	NCBI
mRatBN7.2	10	46,969,729 - 46,988,865 (+)	NCBI

RefSeq Acc Id:

XM_039086899 ⟹ XP_038942827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,469,083 - 47,491,603 (+)	NCBI
mRatBN7.2	10	46,969,729 - 46,988,865 (+)	NCBI

RefSeq Acc Id:

XM_063269901 ⟹ XP_063125971

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	47,469,083 - 47,493,521 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001103114	(Get FASTA)	NCBI Sequence Viewer
	NP_001402701	(Get FASTA)	NCBI Sequence Viewer
	XP_038942826	(Get FASTA)	NCBI Sequence Viewer
	XP_038942827	(Get FASTA)	NCBI Sequence Viewer
	XP_063125971	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A6D7	(Get FASTA)	NCBI Sequence Viewer
	EDM04701	(Get FASTA)	NCBI Sequence Viewer
	EDM04702	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054591.2
	ENSRNOP00000083047.1
	ENSRNOP00000091692.1
	ENSRNOP00055046391
	ENSRNOP00060043218
	ENSRNOP00065009229

RefSeq Acc Id:	NP_001103114 ⟸ NM_001109644
- Peptide Label:	isoform 2
- UniProtKB:	A0A8I6ACK4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFRLLRWRLGRTLLRAAGRRCGGCTARLLPERAGDAGPGAERLRTRGAPARGHRVLPLLAALAW FSRTAAAEEQPGEDATDEAEAEIIQLLKRAKLSIMKDEPEAAELILHDALRLAYESDNKKAITY TYDLAEQLFKATMSYLLGGGMKQEDNAIVEISLKLANIYAAQNKQEFALAGYEFCISTLEGKIE REKELAEDIMSEERANTYLLLGMCLDSCARYLLFSKQLSQAQRMYEKALQICQEIQGERHPQTI VLMSDLATALDAQGHFDDAYIYMQRASDLAREINHPELHMVLSNLAAILIHRERYTQAKEIYQE ALKQAELKRDEFSVQHIREELAELSRKSRLLT hide sequence

Ensembl Acc Id:

ENSRNOP00000054591 ⟸ ENSRNOT00000057777

RefSeq Acc Id:	XP_038942826 ⟸ XM_039086898
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038942827 ⟸ XM_039086899
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000083047 ⟸ ENSRNOT00000112760

Ensembl Acc Id:

ENSRNOP00000091692 ⟸ ENSRNOT00000118989

RefSeq Acc Id:	NP_001402701 ⟸ NM_001415772
- Peptide Label:	isoform 1
- UniProtKB:	D4A6D7 (UniProtKB/Swiss-Prot), D4A3Z0 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063125971 ⟸ XM_063269901
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A6D7-F1-model_v2	AlphaFold	D4A6D7	1-365	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697271

Promoter ID:

EPDNEW_R7796

Type:

initiation region

Name:

Ttc19_1

Description:

tetratricopeptide repeat domain 19

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	48,599,317 - 48,599,377	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1582808	AgrOrtholog
BioCyc Gene	G2FUF-24777	BioCyc
Ensembl Genes	ENSRNOG00000002977	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055032537	UniProtKB/Swiss-Prot
	ENSRNOG00060029885	UniProtKB/Swiss-Prot
	ENSRNOG00065007941	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000057777.3	UniProtKB/Swiss-Prot
	ENSRNOT00000112760.1	UniProtKB/Swiss-Prot
	ENSRNOT00000118989.1	UniProtKB/TrEMBL
	ENSRNOT00055056238	UniProtKB/Swiss-Prot
	ENSRNOT00060051965	UniProtKB/Swiss-Prot
	ENSRNOT00065012531	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TPR_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TTC19	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:691506	UniProtKB/Swiss-Prot
NCBI Gene	691506	ENTREZGENE
PANTHER	PTHR13143	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TETRATRICOPEPTIDE REPEAT PROTEIN 19, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TPR_10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TPR_12	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ttc19	PhenoGen
PROSITE	TPR_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002977	RatGTEx
	ENSRNOG00055032537	RatGTEx
	ENSRNOG00060029885	RatGTEx
	ENSRNOG00065007941	RatGTEx
SMART	TPR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6ACK4	ENTREZGENE, UniProtKB/TrEMBL
	D4A3Z0	ENTREZGENE
	D4A6D7	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	D4A3Z0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-06-15	Ttc19	tetratricopeptide repeat domain 19	RGD1311797	similar to RIKEN cDNA 2810460C24	Data merged from RGD:1311797	1643240	APPROVED
2008-07-08	Ttc19	tetratricopeptide repeat domain 19	LOC687312	similar to Tetratricopeptide repeat protein 19 (TPR repeat protein 19)	Data merged from RGD:1586585	1643240	APPROVED
2008-04-30	RGD1311797	similar to RIKEN cDNA 2810460C24	RGD1311797_predicted	similar to RIKEN cDNA 2810460C24 (predicted)	'predicted' is removed	2292626	APPROVED
2008-03-06	Ttc19	tetratricopeptide repeat domain 19	LOC691506	similar to Tetratricopeptide repeat protein 19 (TPR repeat protein 19)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC691506	similar to Tetratricopeptide repeat protein 19 (TPR repeat protein 19)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687312	similar to Tetratricopeptide repeat protein 19 (TPR repeat protein 19)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-20	RGD1311797_predicted	similar to RIKEN cDNA 2810460C24 (predicted)	LOC287389_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC287389_predicted	similar to RIKEN cDNA 2810460C24 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM