Advanced Search (OLGA)

Gene: Fbxo27 (F-box protein 27) Rattus norvegicus

Analyze

Symbol:

Fbxo27

Name:

F-box protein 27

RGD ID:

1563982

Description:

Predicted to contribute to ubiquitin protein ligase activity. Predicted to be involved in ERAD pathway; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; and glycoprotein catabolic process. Predicted to be part of SCF ubiquitin ligase complex. Predicted to be active in cytoplasm. Orthologous to human FBXO27 (F-box protein 27); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

F-box only protein 27; hypothetical protein LOC499114; LOC499114; MGC108905; rCG54033-like; RGD1563982; similar to F-box only protein 27; uncharacterized protein LOC499114

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FBXO27 (F-box protein 27)	HGNC	HomoloGene, NCBI
Mus musculus (house mouse):	Fbxo27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fbxo27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FBXO27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FBXO27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fbxo27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FBXO27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fbxo27 (F-box protein 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FBXO17 (F-box protein 17)	HGNC	OrthoDB
Homo sapiens (human):	DPH1 (diphthamide biosynthesis 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FBXO27 (F-box protein 27)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fbxo27 (F-box protein 27)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C14B1.3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,092,900 - 93,115,312 (+)	NCBI		GRCr8
mRatBN7.2	1	83,965,426 - 83,987,781 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,965,986 - 83,987,778 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	89,390,766 - 89,397,653 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,849,822 - 97,856,709 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,146,629 - 91,153,516 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	86,872,808 - 86,878,709 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	1	88,054,843 - 88,060,744 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,800,440 - 83,806,448 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	78,373,424 - 78,380,351 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

maturity-onset diabetes of the young type 1 (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

amitrole (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

epoxiconazole (ISO)

fipronil (EXP)

indole-3-methanol (EXP)

lead(0) (ISO)

leflunomide (ISO)

maneb (ISO)

N-methyl-4-phenylpyridinium (ISO)

orphenadrine (EXP)

ozone (ISO)

paraquat (ISO)

perfluorohexanesulfonic acid (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triadimefon (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ERAD pathway (IBA)

glycoprotein catabolic process (IBA)

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process (IBA)

Cellular Component

cytoplasm (IBA)

SCF ubiquitin ligase complex (IBA,ISO)

Molecular Function

protein binding (ISO)

ubiquitin protein ligase activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18203720	PMID:19028597

Genomics

Comparative Map Data

Fbxo27
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	93,092,900 - 93,115,312 (+)	NCBI		GRCr8
mRatBN7.2	1	83,965,426 - 83,987,781 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	83,965,986 - 83,987,778 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	89,390,766 - 89,397,653 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	97,849,822 - 97,856,709 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	91,146,629 - 91,153,516 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	86,872,808 - 86,878,709 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	1	88,054,843 - 88,060,744 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	83,800,440 - 83,806,448 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	78,373,424 - 78,380,351 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

FBXO27
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	39,005,842 - 39,032,549 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	38,990,714 - 39,032,785 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	39,514,661 - 39,523,189 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	44,206,501 - 44,215,038 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	44,206,503 - 44,215,038	NCBI
Celera	19	36,317,092 - 36,325,633 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	35,961,841 - 35,970,384 (-)	NCBI		HuRef
CHM1_1	19	39,515,013 - 39,523,556 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	41,809,624 - 41,837,135 (-)	NCBI		T2T-CHM13v2.0

Fbxo27
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	28,392,205 - 28,398,763 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	28,392,274 - 28,398,763 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	28,692,780 - 28,699,338 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	28,692,849 - 28,699,338 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	29,477,868 - 29,484,357 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	28,401,609 - 28,408,094 (+)	NCBI		MGSCv36	mm8
Celera	7	23,258,883 - 23,265,372 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	16.89	NCBI

Fbxo27
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	518,769 - 525,051 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	520,321 - 525,051 (+)	NCBI	ChiLan1.0	ChiLan1.0

FBXO27
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	45,302,951 - 45,330,192 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	47,173,467 - 47,200,577 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	36,113,773 - 36,133,009 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	44,674,775 - 44,681,873 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	44,675,354 - 44,681,541 (-)	Ensembl	panpan1.1		panPan2

FBXO27
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	114,120,617 - 114,145,295 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	114,120,638 - 114,127,100 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	113,522,347 - 113,546,953 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	114,720,423 - 114,745,019 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	114,720,378 - 114,726,839 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	114,278,360 - 114,285,254 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	113,911,520 - 113,936,119 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	114,906,958 - 114,931,588 (+)	NCBI		UU_Cfam_GSD_1.0

Fbxo27
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	13,502,958 - 13,508,785 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	1,931,025 - 1,936,526 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	1,931,036 - 1,936,548 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FBXO27
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	33,611,205 - 33,630,008 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	33,621,386 - 33,629,223 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	11,625,890 - 11,653,587 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fbxo27
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	12,370,117 - 12,375,180 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fbxo27
145 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	15
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000071239
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Markers in Region

RH132644

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	83,987,556 - 83,987,747 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	86,878,485 - 86,878,675	NCBI	Rnor6.0
Rnor_5.0	1	88,060,520 - 88,060,710	UniSTS	Rnor5.0
RGSC_v3.4	1	83,806,911 - 83,807,101	UniSTS	RGSC3.4
Celera	1	78,380,127 - 78,380,317	UniSTS
RH 3.4 Map	1	840.6	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001110491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270889	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000071239 ⟹ ENSRNOP00000066427

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,966,230 - 83,987,778 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103770 ⟹ ENSRNOP00000093698

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	83,965,986 - 83,987,778 (+)	Ensembl

RefSeq Acc Id:

NM_001110491 ⟹ NP_001103961

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,108,441 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,980,910 - 83,987,781 (+)	NCBI
Rnor_6.0	1	86,872,808 - 86,878,709 (+)	NCBI
Rnor_5.0	1	88,054,843 - 88,060,744 (+)	NCBI
Celera	1	78,373,424 - 78,380,351 (+)	RGD

Sequence:

show sequence

GTCACTCCAAGTGGTTGATTGTTGCGGAACCGCGCAGACTGTGCCAGAGCCCTGGCCTAATCTG
TGACCCCTGGTAGATTCCCACGCTGTCCGCGGATAGCCGGAAGGAGTCAAAACCAAGCGGGGCG
CGGCGACCATGGGTGCCTGGACTTCCAGAACCCGGATCCCTATGCCGGAGCCCGATTCCCAGGA
GGCCCTGGACCTGAGTCGACTGCCCCCGGAGCTGCTCCTGCTGGTACTGAGCCACGTGCCCCCG
CGCACGCTGCTGGTACACTGCCGCCGGGTCTGCCGCGCCTGGCGCGCGTTGGTGGATGGCCAGG
CCCTTTGGCTGCTGCTGCTGGCCCGAGACCACAGCGCAGCGGGCCGCGCCCTGTTGACGTTAGC
CCGCCGCTGCCTGCCCCCAGCCCGCGAAGGCACGCCCTGCCCGCTGGGCCAATTCTGCGCATTA
AGACCGCTAGGACGCAACCTCCTCTGCAACCCCTGTGGCCAAGAGGGCCTGCGCAAGTGGATGG
TGCGGCATGGTGGGGATGGCTGGGTGGTGGAGAAGAACAGGAAACCTGTACCTGGGGCCCCCTC
ACAGACCTGCTTCGTGACTTCCTTCAGCTGGTGTCGAAAGAAGCAGGTTGTGGACCTAGAGGAG
AAGGGTCTATGGCCAGAGCTGCTGGACAGTGGTGGTGTGGAGATTGCTGTGTCTGACTGGTGGG
GAGCTCGACACGACAGTGGCTGTAAGTACCGTCTCTTTGTCACGCTTCTTGACGCTCACCAGAA
CGTCATAGAGAAGTTCTCCTCTGTGCCGGACCCCATTGAACAGTGGAACAACGATGTCTACCTG
CAGGTCACCCACGTGTTCTCCAACATCAGGAGGGGCGTCCGTTTTGTGTCTTTTGAACACTGGG
GCCAGGACACACAGTTCTGGGCTGGCCACTATGGGGCCAGAATGACGAACTCCAGCGTGATTGT
ACGAGTCTGTCCATCCTAGTCAAAAGGCCACCATTTTGACAAGACAATCTGACTGTGCCTTCCT
GGAGCTGTCATCTGGAAACCCTCATGAGTCAAGCACTGTCCCTCCCTGGTTCATGAAACTTTAG
GATCCACTGAAGGGTCCTGCTTGGCCTTTTTTCAGAGTCTGGAACACGGAAGTCCTCCATCAGG
TCTGCCTGTTGCTGCTGCTTTAGAGCATGGGTGCCTGGGTGCCCGGATGCACAGGTGCCTAGAT
GCACGGGTGCCCTGATGCATGGGTTCCCTGATGCATGGGTGCATGCTGGTCTTAGATCACAAGC
TGTCCCCGATATTGATCCCTGACCCTTTTTTGAGACAGATGCCTTTGGCGCTTTGTGCTGGGAC
TACAGGCACACACTGACACCACTCAGCTTTGTGCAGTGCTGGGGATGAGCCCAGGGTTTCGTGC
ATGCCAGGCAAGCATTTTGCTCTCCGAGCAACATGCCAGCATCCCCTCTGGTCACATGCTGTTT
CTGCCTCAGGGACTTTCTCTGTCCCTTCACTGAAGCCCTCTACTTATGGCTGAACTCAGAATTT
ATGGTTAGCAAAACTCCAGCTCCCTTGGGTAAGGAACCAAAGCTTTCTTGACTACAACCAGGCT
TCCGTATTGAAGGGTGTCTTAGGGTATCTACCCACAGATTTTCTCCAAACAATTAGGAAGTGCC
TAGAGCCCAGGCCCTGATCATCACAGATGTCTATAATTGTGTTATATTTAAAGTTACCTTTCAT
TTTCTCAAACAATGAGAGAATAACACACTGGCAATATCTACCTGCCAATTGCACTGTAATAAAT
TGATTATTTTGCCTAAAAAAAACAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039087233 ⟹ XP_038943161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,092,900 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,965,478 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087244 ⟹ XP_038943172

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,094,097 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,966,556 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087255 ⟹ XP_038943183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,094,104 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,966,571 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087259 ⟹ XP_038943187

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,108,572 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,980,435 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087261 ⟹ XP_038943189

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,350 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,969,609 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087268 ⟹ XP_038943196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,350 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,969,609 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087278 ⟹ XP_038943206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,350 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,969,609 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_039087284 ⟹ XP_038943212

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,350 - 93,115,312 (+)	NCBI
mRatBN7.2	1	83,969,608 - 83,987,781 (+)	NCBI

RefSeq Acc Id:

XM_063270883 ⟹ XP_063126953

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,093,064 - 93,114,332 (+)	NCBI

RefSeq Acc Id:

XM_063270885 ⟹ XP_063126955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,093,019 - 93,112,747 (+)	NCBI

RefSeq Acc Id:

XM_063270886 ⟹ XP_063126956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,350 - 93,115,312 (+)	NCBI

RefSeq Acc Id:

XM_063270889 ⟹ XP_063126959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,096,351 - 93,115,312 (+)	NCBI

RefSeq Acc Id:

XM_063270892 ⟹ XP_063126962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	93,094,097 - 93,112,747 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001103961	(Get FASTA)	NCBI Sequence Viewer
	XP_038943161	(Get FASTA)	NCBI Sequence Viewer
	XP_038943172	(Get FASTA)	NCBI Sequence Viewer
	XP_038943183	(Get FASTA)	NCBI Sequence Viewer
	XP_038943187	(Get FASTA)	NCBI Sequence Viewer
	XP_038943189	(Get FASTA)	NCBI Sequence Viewer
	XP_038943196	(Get FASTA)	NCBI Sequence Viewer
	XP_038943206	(Get FASTA)	NCBI Sequence Viewer
	XP_038943212	(Get FASTA)	NCBI Sequence Viewer
	XP_063126953	(Get FASTA)	NCBI Sequence Viewer
	XP_063126955	(Get FASTA)	NCBI Sequence Viewer
	XP_063126956	(Get FASTA)	NCBI Sequence Viewer
	XP_063126959	(Get FASTA)	NCBI Sequence Viewer
	XP_063126962	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91204	(Get FASTA)	NCBI Sequence Viewer
	EDM07883	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066427.3
	ENSRNOP00000093698.1

RefSeq Acc Id:

NP_001103961 ⟸ NM_001110491

- UniProtKB:

A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGAWTSRTRIPMPEPDSQEALDLSRLPPELLLLVLSHVPPRTLLVHCRRVCRAWRALVDGQALW
LLLLARDHSAAGRALLTLARRCLPPAREGTPCPLGQFCALRPLGRNLLCNPCGQEGLRKWMVRH
GGDGWVVEKNRKPVPGAPSQTCFVTSFSWCRKKQVVDLEEKGLWPELLDSGGVEIAVSDWWGAR
HDSGCKYRLFVTLLDAHQNVIEKFSSVPDPIEQWNNDVYLQVTHVFSNIRRGVRFVSFEHWGQD
TQFWAGHYGARMTNSSVIVRVCPS

hide sequence

RefSeq Acc Id:	XP_038943161 ⟸ XM_039087233
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943172 ⟸ XM_039087244
- Peptide Label:	isoform X2
- UniProtKB:	M0RA85 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943183 ⟸ XM_039087255
- Peptide Label:	isoform X2
- UniProtKB:	M0RA85 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943212 ⟸ XM_039087284
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943189 ⟸ XM_039087261
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943206 ⟸ XM_039087278
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943196 ⟸ XM_039087268
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943187 ⟸ XM_039087259
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AGA4 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000066427 ⟸ ENSRNOT00000071239

Ensembl Acc Id:

ENSRNOP00000093698 ⟸ ENSRNOT00000103770

RefSeq Acc Id:	XP_063126955 ⟸ XM_063270885
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063126953 ⟸ XM_063270883
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063126962 ⟸ XM_063270892
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_063126956 ⟸ XM_063270886
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126959 ⟸ XM_063270889
- Peptide Label:	isoform X6
- UniProtKB:	A6J9K0 (UniProtKB/TrEMBL), Q5BK51 (UniProtKB/TrEMBL)

Protein Domains

F-box FBA

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RA85-F1-model_v2	AlphaFold	M0RA85	1-235	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563982	AgrOrtholog
BioCyc Gene	G2FUF-60230	BioCyc
Ensembl Genes	ENSRNOG00000050453	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000071239.3	UniProtKB/TrEMBL
	ENSRNOT00000103770.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1280.50	UniProtKB/TrEMBL
	Galactose-binding domain-like	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7380540	IMAGE-MGC_LOAD
InterPro	F-box-assoc_dom	UniProtKB/TrEMBL
	F-box_dom_cyclin-like	UniProtKB/TrEMBL
	F-box_dom_like	UniProtKB/TrEMBL
	F-box_only	UniProtKB/TrEMBL
	Galactose-bd-like	UniProtKB/TrEMBL
KEGG Report	rno:499114	UniProtKB/TrEMBL
MGC_CLONE	MGC:108905	IMAGE-MGC_LOAD
NCBI Gene	499114	ENTREZGENE
PANTHER	F-BOX ONLY PROTEIN 27	UniProtKB/TrEMBL
	PTHR12125	UniProtKB/TrEMBL
Pfam	F-box	UniProtKB/TrEMBL
	FBA	UniProtKB/TrEMBL
PhenoGen	Fbxo27	PhenoGen
PROSITE	FBA	UniProtKB/TrEMBL
	FBOX	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000050453	RatGTEx
SMART	FBA	UniProtKB/TrEMBL
	FBOX	UniProtKB/TrEMBL
Superfamily-SCOP	F-box_dom_Skp2-like	UniProtKB/TrEMBL
	Gal_bind_like	UniProtKB/TrEMBL
UniProt	A0A8I6AGA4	ENTREZGENE, UniProtKB/TrEMBL
	A6J9K0	ENTREZGENE, UniProtKB/TrEMBL
	M0RA85	ENTREZGENE, UniProtKB/TrEMBL
	Q5BK51	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-25	Fbxo27	F-box protein 27	RGD1563982	similar to F-box only protein 27	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	RGD1563982	similar to F-box only protein 27	LOC100363250	rCG54033-like	Data merged from RGD:2323390	1643240	APPROVED
2010-05-06	LOC100363250	rCG54033-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	RGD1563982	similar to F-box only protein 27	RGD1563982_predicted	similar to F-box only protein 27 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563982_predicted	similar to F-box only protein 27 (predicted)	LOC499114	similar to F-box only protein 27	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499114	similar to F-box only protein 27			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar