Advanced Search (OLGA)

Gene: Sbk2 (SH3 domain binding kinase family, member 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Sbk2

Name:

SH3 domain binding kinase family, member 2

RGD ID:

1563279

Description:

Predicted to enable MAP kinase kinase activity. Predicted to be involved in MAPK cascade. Orthologous to human SBK2 (SH3 domain binding kinase family member 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC308340; LOC691411; MGC187475; RGD1563279; serine/threonine-protein kinase SBK2; SH3-binding domain kinase family, member 2; similar to protein kinase Bsk146

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SBK2 (SH3 domain binding kinase family member 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sbk2 (SH3-binding domain kinase family, member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sbk2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SBK2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SBK2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sbk2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100621492 (serine/threonine-protein kinase SBK2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SBK2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sbk2 (SH3 domain binding kinase family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Sbk2 (SH3-binding domain kinase family, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SBK2 (SH3 domain binding kinase family member 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-8e10.3	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C01C4.3	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4945	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	itm2a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sbk2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	77,902,926 - 77,910,758 (+)	NCBI		GRCr8
mRatBN7.2	1	68,874,081 - 68,881,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	68,874,152 - 68,881,916 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	74,219,238 - 74,227,004 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	82,783,540 - 82,791,306 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	75,932,266 - 75,940,127 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,425,728 - 72,433,494 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,425,707 - 72,433,488 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	76,102,583 - 76,110,349 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	67,612,797 - 67,620,563 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	68,237,321 - 68,245,087 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sbk2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of SBK2 mRNA	CTD	PMID:32109520
Sbk2	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of SBK2 mRNA	CTD	PMID:35163327
Sbk2	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SBK2 mRNA	CTD	PMID:35163327
Sbk2	Rat	aristolochic acid A	increases expression	ISO	SBK2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of SBK2 mRNA	CTD	PMID:33212167
Sbk2	Rat	arsane	affects methylation	ISO	SBK2 (Homo sapiens)	6480464	Arsenic affects the methylation of SBK2 gene	CTD	PMID:25304211
Sbk2	Rat	arsane	decreases expression	ISO	SBK2 (Homo sapiens)	6480464	Arsenic results in decreased expression of SBK2 mRNA	CTD	PMID:36861143
Sbk2	Rat	arsenic atom	affects methylation	ISO	SBK2 (Homo sapiens)	6480464	Arsenic affects the methylation of SBK2 gene	CTD	PMID:25304211
Sbk2	Rat	arsenic atom	decreases expression	ISO	SBK2 (Homo sapiens)	6480464	Arsenic results in decreased expression of SBK2 mRNA	CTD	PMID:36861143
Sbk2	Rat	benzo[a]pyrene	increases methylation	ISO	SBK2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SBK2 promoter	CTD	PMID:27901495
Sbk2	Rat	benzo[a]pyrene	affects methylation	ISO	SBK2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SBK2 exon	CTD	PMID:27901495
Sbk2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SBK2 mRNA	CTD	PMID:25181051
Sbk2	Rat	bisphenol A	increases expression	ISO	Sbk2 (Mus musculus)	6480464	bisphenol A results in increased expression of SBK2 mRNA	CTD	PMID:32156529
Sbk2	Rat	bisphenol A	decreases methylation	ISO	SBK2 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of SBK2 gene	CTD	PMID:31601247
Sbk2	Rat	bisphenol A	decreases methylation	EXP		6480464	bisphenol A results in decreased methylation of SBK2 gene	CTD	PMID:28505145
Sbk2	Rat	cadmium atom	increases expression	ISO	SBK2 (Homo sapiens)	6480464	Cadmium results in increased expression of SBK2 mRNA	CTD	PMID:24376830
Sbk2	Rat	doxorubicin	decreases expression	ISO	Sbk2 (Mus musculus)	6480464	Doxorubicin results in decreased expression of SBK2 mRNA	CTD	PMID:36227756
Sbk2	Rat	ethylparaben	decreases expression	ISO	SBK2 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of SBK2 mRNA	CTD	PMID:37690743
Sbk2	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	SBK2 (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of SBK2 mRNA	CTD	PMID:24810058
Sbk2	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SBK2 mRNA	CTD	PMID:35163327
Sbk2	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of SBK2 mRNA	CTD	PMID:35163327
Sbk2	Rat	pioglitazone	multiple interactions	ISO	Sbk2 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of SBK2 mRNA	CTD	PMID:27935865
Sbk2	Rat	sunitinib	decreases expression	ISO	SBK2 (Homo sapiens)	6480464	Sunitinib results in decreased expression of SBK2 mRNA	CTD	PMID:31533062
Sbk2	Rat	triclosan	increases expression	ISO	SBK2 (Homo sapiens)	6480464	Triclosan results in increased expression of SBK2 mRNA	CTD	PMID:30510588
Sbk2	Rat	triptonide	increases expression	ISO	Sbk2 (Mus musculus)	6480464	triptonide results in increased expression of SBK2 mRNA	CTD	PMID:33045310
Sbk2	Rat	valproic acid	increases methylation	ISO	SBK2 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of SBK2 gene	CTD	PMID:29154799
Sbk2	Rat	XL147	multiple interactions	ISO	Sbk2 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of SBK2 mRNA	CTD	PMID:27935865

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sbk2	Rat	MAPK cascade	involved_in	IBA	FB:FBgn0010269 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sbk2	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sbk2	Rat	ATP binding	enables	IEA	InterPro:IPR000719 and InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Sbk2	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sbk2	Rat	MAP kinase kinase activity	enables	IBA	CGD:CAL0000184846 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sbk2	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sbk2	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719 and InterPro:IPR008271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Sbk2	Rat	protein serine kinase activity	enables	IEA	RHEA:17989	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Sbk2	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sbk2	Rat	protein serine/threonine kinase activity	enables	IEA	EC:2.7.11.1	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Sbk2	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15632090

Sbk2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	77,902,926 - 77,910,758 (+)	NCBI		GRCr8
mRatBN7.2	1	68,874,081 - 68,881,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	68,874,152 - 68,881,916 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	74,219,238 - 74,227,004 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	82,783,540 - 82,791,306 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	75,932,266 - 75,940,127 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	72,425,728 - 72,433,494 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,425,707 - 72,433,488 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	76,102,583 - 76,110,349 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	67,612,797 - 67,620,563 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	68,237,321 - 68,245,087 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

SBK2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	55,528,611 - 55,537,133 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	55,528,611 - 55,537,133 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	56,039,978 - 56,048,500 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	60,732,912 - 60,739,473 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	53,080,945 - 53,087,914 (-)	NCBI		Celera
Cytogenetic Map	19	q13.42	NCBI
HuRef	19	52,354,121 - 52,361,177 (-)	NCBI		HuRef
CHM1_1	19	56,035,133 - 56,042,101 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	58,624,919 - 58,633,076 (-)	NCBI		T2T-CHM13v2.0

Sbk2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	4,959,133 - 4,967,405 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	4,943,511 - 4,967,405 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	4,956,134 - 4,964,406 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	4,940,512 - 4,964,406 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	4,908,683 - 4,915,950 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	4,314,603 - 4,321,869 (-)	NCBI		MGSCv36	mm8
MGSCv36	7	4,560,168 - 4,567,435 (-)	NCBI		MGSCv36	mm8
Celera	7	4,699,060 - 4,706,220 (-)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	2.87	NCBI

Sbk2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955567	778,379 - 783,794 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955567	778,971 - 783,363 (+)	NCBI	ChiLan1.0	ChiLan1.0

SBK2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	61,668,084 - 61,676,919 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	63,396,509 - 63,406,348 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	52,572,218 - 52,582,547 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	61,261,266 - 61,270,268 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

SBK2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	1	102,235,125 - 102,246,047 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	102,831,597 - 102,842,515 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	102,830,592 - 102,842,750 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	102,469,059 - 102,479,759 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	102,180,922 - 102,191,821 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	102,944,368 - 102,955,068 (+)	NCBI		UU_Cfam_GSD_1.0

Sbk2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	1,813,230 - 1,819,362 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936886	739,878 - 746,016 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936886	739,863 - 745,971 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100621492
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	59,672,298 - 59,677,670 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	59,672,306 - 59,689,626 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	54,630,304 - 54,637,134 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SBK2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	48,115,711 - 48,126,811 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	48,116,111 - 48,123,093 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	764,089 - 779,286 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sbk2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	1,840,466 - 1,846,060 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	1,840,466 - 1,845,852 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Sbk2
46 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	318
Count of miRNA genes:	157
Interacting mature miRNAs:	188
Transcripts:	ENSRNOT00000058956
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

BE113042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	68,873,030 - 68,873,195 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,424,607 - 72,424,771	NCBI	Rnor6.0
Rnor_5.0	1	76,111,306 - 76,111,470	UniSTS	Rnor5.0
RGSC_v3.4	1	67,611,676 - 67,611,840	UniSTS	RGSC3.4
Celera	1	68,246,044 - 68,246,208	UniSTS
Cytogenetic Map	1	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
5	11	49	44	45	42	13	24	13	6	140	96	24	18	48	29


RefSeq Transcripts	NM_001127539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058956 ⟹ ENSRNOP00000055736

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	68,874,152 - 68,881,916 (+)	Ensembl
Rnor_6.0 Ensembl	1	72,425,707 - 72,433,488 (+)	Ensembl

RefSeq Acc Id:

NM_001127539 ⟹ NP_001121011

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	77,902,992 - 77,910,758 (+)	NCBI
mRatBN7.2	1	68,874,152 - 68,881,918 (+)	NCBI
Rnor_6.0	1	72,425,728 - 72,433,494 (+)	NCBI
Rnor_5.0	1	76,102,583 - 76,110,349 (-)	NCBI
RGSC_v3.4	1	67,612,797 - 67,620,563 (+)	RGD
Celera	1	68,237,321 - 68,245,087 (-)	RGD

Sequence:

show sequence

GTCAGACAAGCCTTGGAGAAGGCAAGGTCTGGAGCTCTGAGCCCAGGTCAGAAGTAGGGCAAGGTTAACCGGCCTGAGGGAAGGCTGCAGTTGAACAGGAAAACAGGTGGCAAGAGTCCTGGCCCCTC
GACAGGACAAGAGACACCTTGAAGCAATCGAGTGCTTTAGTGTTGGTGACAGAAATCAAGGCCCAATTTGTAAATGCCTGGCAAACAGTCAGAAGACAGGCCAATGGAAGTGGCAGCTGTGGAGGATG
GAGGTGATGAAGGCTTGGGAGGCCTCACGGTAGAGGAGCTGCAGCAGGGTCAGGAGGCTGCTCTGGCCTTGGAAGACATGATGGCTCTGAGTGCCCAGACCCTGGTCCGAACAGAGGTGGAAGAGTTG
TACGAGGAAGTGCGCCCCCTGGGCCAGGGCCGGTTCGGTCGTGTCCTGCTGGTTACTCACCGCCAGAAAGGAACACCCCTGGCGCTGAAGCAGCTCCCCAAGCACTCCACTTCCCTCCGCAGCTTCCT
GTATGAGTTCTGCGTGGGCCTCTCGCTTGGCACACATCCAGCCATCGTGGCAGCCTATGGCATTGGCATTGAGTCAGCCAATTCCTACAGCTTCCTGACAGAGCCTGTTCTCCACGGGGACCTCATCA
CCTTCATCAAGCCCAAGGTGGGTCTCCCACAGCCAGCAGTCCAGCGCTGTGCCGCCCAACTGGCCTCTGCCCTGGAGCACATTCACTCCCATGGCCTGGTGTACCGGGACTTGAAGCCAGAGAATGTG
CTGGTGTGTGACCCAGCCTGCCAGCGTGTCAAACTGACAGACTTTGGCCACACCCGGCCCCGAGGGACAATGCTCCGACTCACTGGGCCACCTATCCCCTACACTGCCCCTGAGCTCTGTGCCCCACC
CCCCCTCCCTGAGGGACTACCCATCCAACCTGCCCTGGATGCCTGGGCTCTGGGGGTCCTGATCTTCTGCCTTCTTACTGGCTACTTCCCCTGGGACCAGCCCCTGGTGGAGGTTGACCCTTTCTTCG
AAGACTTTCTCATCTGGCAGGCTTCTGGCCAGCCCCAAGACCGGCCACAGCCATGGTATAACCTGTCACCTGCAGCAGACACTCTCCTGTGGGGGCTGCTGGATCCTCACCCCCGGAAGCGGAACCCT
GTAAGCTCCATCAAGAGCTATCTAGGCCAACCCTGGAAGCAGAGGGAGGAGGGGGCTGAGGAATTGACAAAGGAGCTGAGAGAAGATGGGTCGAGAGGAGGACAGGAGGCTGCAAAGGGAGAGCAACC
TGCATGCTGAGACCGGCTTAGCCTGAGCTGCCTGGCTGTGGCCTCTTCTCTGTTTTCAATCTGTCTCTGATCTGTCCTATGTGTTATGTGTGTCCCTCCTTTATGCTGTGTGTGCATCCGTAAATGTG
TGTATGTGTGCTTATTTGTATATGTGTGCACATGTGTTTATGCGTGTAGACATGCAGATATATGTATCTGTGTGTATGCACACATATGTGTTTCTATGTGTGCATGTGTTCATGTGCGTATATGTATG
TGAACATATGTATCTGTGTATGCACATATGTGTATGTGCATGGCATGTGTGTATGTACATGAGTGTATGTGTATGTGTGTGTATACATGTATATACATGTATCTGTGTACACACATATGTGTGTGCAT
GGCATGTGTGTATGCACGTGAGTGTGTGTGTGTATGTGTGTGGTGCTGTATGTAAATCAGAGGACTTTTAGGAGTCAGCCCTCTTCTTCCACCTTTGAGCCCAGCCACGGAACTGAATTCTTGTCAGT
CTTCGAGTGCCTTTACCTATGGAAGCCGTCTTGCAGGCTCTGGTCTATAACTCTGGATCCTCCTGCCTCAGCTTCCTGAGTCTTGGGATAGCAGGCATGCACCATGCTCAGCTGTCCTGCATAGCTTT
CGCCATCCCACCCACCTCAGCTAGCCTTCCCCACAAACCCAGGTAAAATGGCCACCTGCTGTGAACTTCACAATCCTAGGCCCCTCTGTACTTCCATGGCGTGTGCCGTACCTTTACTAACTGCTTAT
TTTCTGAACCCCCAGAGGGTTGGTTTTGACCCCTGAAGGAATGACCCTACATCTCTGAGCAATGCCCAGCCTGCAGCCAATGAGTAGACACAGCTACTCAGCATTGCTCCCCACTACTGGGCCTCTCA
CCCTCTTCATCACTGTCCCCTGGCTCTCTCATGCGGCTTCGCTCCACTCAGAGCTGCTCTGGCTTTTGTCGCTCACCCACCTGCATGCTGGGACAGCACCTTCTGTGTGAGGTACACTTGTCCAGCTG
CTCTCTGCAAATAAAGTTCCCCAGGCAACTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039091543 ⟹ XP_038947471

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	77,902,926 - 77,910,758 (+)	NCBI
mRatBN7.2	1	68,874,081 - 68,881,056 (+)	NCBI


Protein RefSeqs	NP_001121011	(Get FASTA)	NCBI Sequence Viewer
	XP_038947471	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61893	(Get FASTA)	NCBI Sequence Viewer
	B1WBU5	(Get FASTA)	NCBI Sequence Viewer
	EDL75876	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000055736
	ENSRNOP00000055736.2

RefSeq Acc Id:

NP_001121011 ⟸ NM_001127539

- UniProtKB:

B1WBU5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPGKQSEDRPMEVAAVEDGGDEGLGGLTVEELQQGQEAALALEDMMALSAQTLVRTEVEELYEEVRPLGQGRFGRVLLVTHRQKGTPLALKQLPKHSTSLRSFLYEFCVGLSLGTHPAIVAAYGIGIE
SANSYSFLTEPVLHGDLITFIKPKVGLPQPAVQRCAAQLASALEHIHSHGLVYRDLKPENVLVCDPACQRVKLTDFGHTRPRGTMLRLTGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLIFCL
LTGYFPWDQPLVEVDPFFEDFLIWQASGQPQDRPQPWYNLSPAADTLLWGLLDPHPRKRNPVSSIKSYLGQPWKQREEGAEELTKELREDGSRGGQEAAKGEQPAC

hide sequence

Ensembl Acc Id:

ENSRNOP00000055736 ⟸ ENSRNOT00000058956

RefSeq Acc Id:	XP_038947471 ⟸ XM_039091543
- Peptide Label:	isoform X1
- UniProtKB:	B1WBU5 (UniProtKB/Swiss-Prot)

Protein Domains

Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WBU5-F1-model_v2	AlphaFold	B1WBU5	1-362	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60872	BioCyc
Ensembl Genes	ENSRNOG00000038625	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000058956	ENTREZGENE
	ENSRNOT00000058956.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:691411	UniProtKB/Swiss-Prot
NCBI Gene	Sbk2	ENTREZGENE
PANTHER	PROTEIN KINASE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	SERINE/THREONINE-PROTEIN KINASE SBK1	UniProtKB/Swiss-Prot
Pfam	Pkinase	UniProtKB/Swiss-Prot
PhenoGen	Sbk2	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000038625	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	B1WBU5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-11	Sbk2	SH3 domain binding kinase family, member 2	Sbk2	SH3-binding domain kinase family, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-12	Sbk2	SH3-binding domain kinase family, member 2	RGD1563279	similar to protein kinase Bsk146	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-22	RGD1563279	similar to protein kinase Bsk146	LOC691411	similar to protein kinase Bsk146	Data merged from RGD:1583962	737654	APPROVED
2008-04-30	RGD1563279	similar to protein kinase Bsk146	RGD1563279_predicted	similar to protein kinase Bsk146 (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-19	LOC691411	similar to protein kinase Bsk146			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1563279_predicted	similar to protein kinase Bsk146 (predicted)	LOC308340	similar to protein kinase Bsk146	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC308340	similar to protein kinase Bsk146			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message