Atp6ap2 (ATPase H+ transporting accessory protein 2)

Advanced Search (OLGA)

Gene: Atp6ap2 (ATPase H+ transporting accessory protein 2) Rattus norvegicus

Analyze

Symbol:

Atp6ap2

Name:

ATPase H+ transporting accessory protein 2

RGD ID:

1561269

Description:

Predicted to enable signaling receptor activity. Predicted to be involved in several processes, including angiotensin maturation; nervous system development; and regulation of signal transduction. Located in apical plasma membrane; cell body; and extracellular space. Is active in synaptic vesicle membrane. Biomarker of hypertension. Human ortholog(s) of this gene implicated in X-linked parkinsonism-spasticity syndrome; congenital disorder of glycosylation type II; and syndromic X-linked intellectual disability Hedera type. Orthologous to human ATP6AP2 (ATPase H+ transporting accessory protein 2); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H(+)-transporting, lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal accessory protein 2; MGC94783; renin receptor; renin/prorenin receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	12,856,708 - 12,883,670 (-)	NCBI		GRCr8
mRatBN7.2	X	10,183,983 - 10,210,948 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	10,183,068 - 10,210,918 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	10,365,151 - 10,392,104 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	13,862,316 - 13,889,268 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	10,131,474 - 10,158,431 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	11,137,889 - 11,164,854 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	11,136,939 - 11,164,915 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	11,936,459 - 11,963,424 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	22,264,078 - 22,291,988 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	10,708,369 - 10,735,267 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Congenital Disorder of Glycosylation Type IIr (ISO)

Craniofacial Abnormalities (ISO)

Fibrosis (ISO)

genetic disease (ISO)

hypertension (IEP)

Neurodevelopmental Disorders (ISO)

ornithine carbamoyltransferase deficiency (ISO)

Prenatal Exposure Delayed Effects (IEP)

syndromic microphthalmia 2 (ISO)

syndromic X-linked intellectual disability Hedera type (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

syndromic X-linked intellectual disability Najm type (ISO)

X-linked parkinsonism-spasticity syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acrolein (ISO)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (EXP)

alpha-pinene (ISO)

amiodarone (EXP)

amitrole (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

auramine O (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

chlordecone (ISO)

chloropicrin (ISO)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

D-glucose (EXP)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glucose (EXP)

isoprenaline (EXP)

L-ethionine (EXP)

lead(0) (ISO)

leflunomide (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nimesulide (EXP)

Nivalenol (ISO)

NS-398 (EXP)

Nutlin-3 (ISO)

omeprazole (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (EXP)

potassium chromate (ISO)

propiconazole (EXP)

rac-lactic acid (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tryptophan (EXP)

valproic acid (EXP,ISO)

valsartan (EXP)

vanadium atom (ISO)

vanadium(0) (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiotensin maturation (IEA,ISO)

biological_process (ND)

central nervous system maturation (IEA,ISO,ISS)

eye pigmentation (IEA,ISO)

head morphogenesis (IEA,ISO)

lysosomal lumen acidification (IEA,ISO,ISS)

positive regulation of canonical Wnt signaling pathway (IEA,ISO,ISS)

positive regulation of transforming growth factor beta1 production (IEA,ISO)

positive regulation of Wnt signaling pathway (IBA,ISO)

regulation of MAPK cascade (IEA,ISO)

rostrocaudal neural tube patterning (IEA,ISO)

synaptic vesicle lumen acidification (IEA,ISO)

Cellular Component

apical plasma membrane (IDA)

autophagosome membrane (IEA)

axon (IEA)

cell body (IDA)

clathrin-coated vesicle membrane (IEA)

dendritic spine membrane (IEA)

endoplasmic reticulum membrane (IEA,ISO)

endosome membrane (IEA,ISO,ISS)

external side of plasma membrane (IBA,IEA,ISO)

extracellular space (IDA)

lysosomal membrane (IEA,ISO,ISS)

lysosome (ISO)

membrane (ISO)

postsynaptic membrane (IEA)

synaptic vesicle membrane (EXP,IDA,IEA,IEP)

vacuolar proton-transporting V-type ATPase complex (IEA,ISO,ISS)

vacuolar proton-transporting V-type ATPase, V0 domain (ISS)

Molecular Function

protein binding (ISO)

signaling receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

renin-angiotensin cascade pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structure of V-ATPase from the mammalian brain.	Abbas YM, etal., Science. 2020 Mar 13;367(6483):1240-1246. doi: 10.1126/science.aaz2924.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats.	Gonzalez AA, etal., Hypertension. 2011 Apr;57(4):859-64. Epub 2011 Feb 14.
4.	Maternal Tryptophan Supplementation Protects Adult Rat Offspring against Hypertension Programmed by Maternal Chronic Kidney Disease: Implication of Tryptophan-Metabolizing Microbiome and Aryl Hydrocarbon Receptor.	Hsu CN, etal., Int J Mol Sci. 2020 Jun 26;21(12):4552. doi: 10.3390/ijms21124552.
5.	Prorenin and (pro)renin receptor: a review of available data from in vitro studies and experimental models in rodents.	Nguyen G and Danser AH, Exp Physiol. 2008 May;93(5):557-63. Epub 2008 Mar 30.
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Characterization of a functional (pro)renin receptor in rat brain neurons.	Shan Z, etal., Exp Physiol. 2008 May;93(5):701-8. Epub 2008 Mar 7.
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12045255	PMID:15489334	PMID:15489960	PMID:15746149	PMID:16374430	PMID:18212268	PMID:18664599	PMID:18756297	PMID:19056867	PMID:19174157	PMID:19199708	PMID:19769609
PMID:19861503	PMID:20093472	PMID:20689062	PMID:21068087	PMID:21483231	PMID:21803797	PMID:22203739	PMID:22684035	PMID:23376485	PMID:23533145	PMID:24817138	PMID:25143455
PMID:25555681	PMID:25668351	PMID:25767135	PMID:25844689	PMID:26984496	PMID:27121029	PMID:27440776	PMID:29127204	PMID:29846109	PMID:30414975	PMID:30952701	PMID:31527264
PMID:32469229	PMID:32757619	PMID:32799674	PMID:32830537	PMID:33547400	PMID:34087284	PMID:34228176	PMID:37286698

Genomics

Comparative Map Data

Atp6ap2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	12,856,708 - 12,883,670 (-)	NCBI		GRCr8
mRatBN7.2	X	10,183,983 - 10,210,948 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	10,183,068 - 10,210,918 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	10,365,151 - 10,392,104 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	13,862,316 - 13,889,268 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	10,131,474 - 10,158,431 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	11,137,889 - 11,164,854 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	11,136,939 - 11,164,915 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	11,936,459 - 11,963,424 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	22,264,078 - 22,291,988 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	10,708,369 - 10,735,267 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

ATP6AP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	40,580,970 - 40,606,848 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	40,579,372 - 40,606,848 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	40,440,222 - 40,466,100 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	40,325,160 - 40,350,833 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	40,196,446 - 40,222,125	NCBI
Celera	X	44,580,390 - 44,606,072 (+)	NCBI		Celera
Cytogenetic Map	X	p11.4	NCBI
HuRef	X	38,171,318 - 38,196,989 (+)	NCBI		HuRef
CHM1_1	X	40,472,702 - 40,498,380 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	39,982,532 - 40,008,405 (+)	NCBI		T2T-CHM13v2.0

Atp6ap2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	12,453,998 - 12,483,290 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	12,454,040 - 12,483,288 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	12,587,759 - 12,617,051 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	12,587,801 - 12,617,049 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	12,164,885 - 12,194,177 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	11,736,552 - 11,773,924 (+)	NCBI		MGSCv36	mm8
Celera	X	10,281,818 - 10,311,001 (+)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	7.42	NCBI

Atp6ap2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955565	2,006,154 - 2,029,921 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATP6AP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	42,225,026 - 42,250,788 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	42,228,419 - 42,254,164 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	33,026,525 - 33,052,252 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	40,730,677 - 40,756,209 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	40,730,677 - 40,756,209 (+)	Ensembl	panpan1.1		panPan2

ATP6AP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	35,050,588 - 35,073,633 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	35,050,606 - 35,073,067 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	22,398,893 - 22,421,901 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	35,099,002 - 35,122,024 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	35,099,006 - 35,122,017 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	35,178,090 - 35,201,096 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	35,150,804 - 35,173,213 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	35,193,579 - 35,216,589 (+)	NCBI		UU_Cfam_GSD_1.0

Atp6ap2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	27,365,515 - 27,392,087 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936502	7,206,172 - 7,233,912 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936502	7,206,226 - 7,232,798 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP6AP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	36,271,223 - 36,300,240 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	36,271,154 - 36,300,240 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	40,369,340 - 40,398,417 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP6AP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	37,742,550 - 37,769,022 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	37,742,545 - 37,769,062 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666076	2,940,061 - 2,966,802 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp6ap2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	14,952,002 - 14,975,900 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624762	14,952,313 - 14,975,678 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp6ap2
71 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	215
Count of miRNA genes:	150
Interacting mature miRNAs:	177
Transcripts:	ENSRNOT00000005138
Prediction methods:	Miranda, Pita, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	1448129	31706553	Rat
1298071	Edpm12	Estrogen-dependent pituitary mass QTL 12	3.2		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	X	2927898	47927898	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1	43491017	Rat
70166	Bp65	Blood pressure QTL 65	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	1447972	11374346	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	4494549	49494549	Rat
10755455	Coatc13	Coat color QTL 13		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	4406000	49406000	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	1447972	20991088	Rat
631204	Gluco15	Glucose level QTL 15		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	X	1623715	22646544	Rat

Markers in Region

BE102970

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	10,185,787 - 10,185,966 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	11,139,694 - 11,139,872	NCBI	Rnor6.0
Rnor_5.0	X	11,938,264 - 11,938,442	UniSTS	Rnor5.0
RGSC_v3.4	X	22,266,804 - 22,266,982	UniSTS	RGSC3.4
Celera	X	10,710,174 - 10,710,352	UniSTS
RH 3.4 Map	X	42.0	UniSTS
Cytogenetic Map	X	q13	UniSTS

BI276143

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	10,183,429 - 10,183,647 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	11,137,336 - 11,137,553	NCBI	Rnor6.0
Rnor_5.0	X	11,935,906 - 11,936,123	UniSTS	Rnor5.0
RGSC_v3.4	X	22,264,446 - 22,264,663	UniSTS	RGSC3.4
Celera	X	10,707,816 - 10,708,033	UniSTS
Cytogenetic Map	X	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB188298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005138 ⟹ ENSRNOP00000005138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	10,183,068 - 10,210,918 (-)	Ensembl
Rnor_6.0 Ensembl	X	11,136,939 - 11,164,915 (-)	Ensembl

RefSeq Acc Id:

NM_001007091 ⟹ NP_001007092

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	12,856,708 - 12,883,670 (-)	NCBI
mRatBN7.2	X	10,183,983 - 10,210,948 (-)	NCBI
Rnor_6.0	X	11,137,889 - 11,164,854 (-)	NCBI
Rnor_5.0	X	11,936,459 - 11,963,424 (-)	NCBI
Celera	X	10,708,369 - 10,735,267 (-)	NCBI

Sequence:

show sequence

CGTCACTCGGTCTGACTGCGGTGCTCGCTCGAGTCCCGGCGTCCCTTTTCGTGTGGCTCATCTC
CGCTTTAGCAGCCGTGGCACCATGGCTGTGCTTGTCGTTCTCCTCTCTTCTCTGGTGTCGAGTG
CTTTAGCGAATGAATTTAGCATATTAAGATCGCCAGGGTCTGTTGTTTTCCGAAATGGAAATTG
GCCTATACCAGGAGATCGAATCCCAGATGTAGCTGCACTGTCCATGGGCTTCTCTGTGAAGGAA
GACCTGTCTTGGCCAGGGCTTGCTGTGGGCAACCTATTCCACCGGCCCCGGGCTACCATTATGG
TGACAGTGAAGGGGGTAGATAAACTGGCTCTCCCCACAGGCAGCGTCATCTCTTACCCTTTGGA
GAATGCAGTTCCCTTTAGTCTTGACAGTGTGGCCAATTCCATTCACTCCTTATTTTCGGAGGAG
ACTCCTGTAGTTTTGCAGTTGGCCCCCAGTGAGGAAAGAGTGTATATGGTGGGGAAAGCAAACT
CTGTATTTGAAGACCTTTCAGTCACATTGCGTCAGCTCCGTAATCGCCTGTTTCAAGAAAACTC
TGTTCTCAACTCGCTCCCCCTCAATTCTCTGAGTAGGAATAATGAAGTTGACCTGCTATTTCTT
TCTGAACTGCAAGTGCTGCATGATATTTCAAGTTTGTTGTCTCGTCATAAGCATCTCGCCAAGG
ATCATTCTCCCGACTTGTATTCACTGGAGCTGGCAGGTTTGGATGAGCTTGGGAAGCGTTATGG
AGAAGACTCTGAACAATTCCGGGATGCTTCTCGGATCCTTGTTGATGCTCTCCAAAAGTTTGCA
GATGACATGTACAGTCTCTATGGTGGGAATGCAGTGGTAGAGTTGGTGACTGTCAAATCATTCG
ACACATCCCTGGTGAGGAAGTCAAGGACCATCCTTGAGACGAAACAAGAGAACACCCAAAGTCC
CTACAACCTTGCGTATAAGTATAATTTGGAGTATTCGGTGGTTTTCAACTTGGTACTGTGGATT
ATGACTGGCTTGGCCTTGGCTGTGATAATCACCTCTTACAACATTTGGAATATGGATCCTGGAT
ATGATAGCATCATTTATAGGATGACAAACCAGAAGATTCGAATGGATTGATTTTCCTTATGCTA
GACTTACTTAGACAACAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001007092	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79339	(Get FASTA)	NCBI Sequence Viewer
	BAD67178	(Get FASTA)	NCBI Sequence Viewer
	EDL97631	(Get FASTA)	NCBI Sequence Viewer
	EDL97632	(Get FASTA)	NCBI Sequence Viewer
	EDL97633	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005138.5
	ENSRNOP00055040860
	ENSRNOP00060033002
	ENSRNOP00065014187
GenBank Protein	Q6AXS4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001007092 ⟸ NM_001007091
- Peptide Label:	precursor
- UniProtKB:	Q6AXS4 (UniProtKB/Swiss-Prot), A6K003 (UniProtKB/TrEMBL), A0A8L2UHU2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVLVVLLSSLVSSALANEFSILRSPGSVVFRNGNWPIPGDRIPDVAALSMGFSVKEDLSWPGL AVGNLFHRPRATIMVTVKGVDKLALPTGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQL APSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRNNEVDLLFLSELQVLH DISSLLSRHKHLAKDHSPDLYSLELAGLDELGKRYGEDSEQFRDASRILVDALQKFADDMYSLY GGNAVVELVTVKSFDTSLVRKSRTILETKQENTQSPYNLAYKYNLEYSVVFNLVLWIMTGLALA VIITSYNIWNMDPGYDSIIYRMTNQKIRMD hide sequence

Ensembl Acc Id:

ENSRNOP00000005138 ⟸ ENSRNOT00000005138

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXS4-F1-model_v2	AlphaFold	Q6AXS4	1-350	view protein structure
PRR	I-TASSER model	Q6AXS4	18-350	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701713

Promoter ID:

EPDNEW_R12237

Type:

initiation region

Name:

Atp6ap2_1

Description:

ATPase H+ transporting accessory protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	11,164,841 - 11,164,901	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561269	AgrOrtholog
BioCyc Gene	G2FUF-3063	BioCyc
Ensembl Genes	ENSRNOG00000003858	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055028685	UniProtKB/Swiss-Prot
	ENSRNOG00060022965	UniProtKB/Swiss-Prot
	ENSRNOG00065011407	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005138.7	UniProtKB/TrEMBL
	ENSRNOT00055049660	UniProtKB/Swiss-Prot
	ENSRNOT00060039956	UniProtKB/Swiss-Prot
	ENSRNOT00065018549	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7106562	IMAGE-MGC_LOAD
InterPro	Renin_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:302526	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94783	IMAGE-MGC_LOAD
NCBI Gene	302526	ENTREZGENE
PANTHER	PTHR13351	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RENIN RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Renin_r	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Atp6ap2	PhenoGen
RatGTEx	ENSRNOG00000003858	RatGTEx
	ENSRNOG00055028685	RatGTEx
	ENSRNOG00060022965	RatGTEx
	ENSRNOG00065011407	RatGTEx
UniProt	A0A8L2UHU2	ENTREZGENE, UniProtKB/TrEMBL
	A6K002_RAT	UniProtKB/TrEMBL
	A6K003	ENTREZGENE, UniProtKB/TrEMBL
	A6K004_RAT	UniProtKB/TrEMBL
	Q6AXS4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Atp6ap2	ATPase H+ transporting accessory protein 2	Atp6ap2	ATPase, H+ transporting, lysosomal accessory protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Atp6ap2	ATPase, H+ transporting, lysosomal accessory protein 2			Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	Atp6ap2	ATPase, H+ transporting, lysosomal accessory protein 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations