Symbol:
Nob1
Name:
NIN1/RPN12 binding protein 1 homolog
RGD ID:
1553773
MGI Page
MGI
Description:
Predicted to enable RNA endonuclease activity. Acts upstream of or within visual perception. Predicted to be located in cytoplasm and nucleolus. Predicted to be part of preribosome, small subunit precursor. Is expressed in nervous system and neural retina. Orthologous to human NOB1 (NIN1 (RPN12) binding protein 1 homolog).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1700021I09Rik; ART; ART-4; MGC118441; MGC144649; MGC144650; nin one binding protein; No; Nob1p; Psmd8; PSMD8 binding protein 1; Psmd8bp1; RNA-binding protein NOB1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NOB1 (NIN1 (RPN12) binding protein 1 homolog) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Nob1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nob1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NOB1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NOB1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nob1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NOB1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NOB1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nob1 (NIN1 (RPN12) binding protein 1 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Nob1 (NIN1 (RPN12) binding protein 1 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NOB1 (NIN1 (RPN12) binding protein 1 homolog)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nob1 (NIN1 (RPN12) binding protein 1 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG2972
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NOB1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y54E10BR.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nob1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 108,139,121 - 108,151,670 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 108,139,118 - 108,151,683 (-) Ensembl GRCm39 Ensembl GRCm38 8 107,412,489 - 107,425,038 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 107,412,486 - 107,425,051 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 109,936,389 - 109,948,938 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 110,301,618 - 110,314,167 (-) NCBI MGSCv36 mm8 Celera 8 111,643,138 - 111,655,687 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 54.12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nob1 Mouse (+)-schisandrin B multiple interactions ISO Nob1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NOB1 mRNA] CTD PMID:31150632 Nob1 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO NOB1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NOB1 mRNA CTD PMID:22079256 Nob1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NOB1 mRNA CTD PMID:36331819 Nob1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of NOB1 mRNA CTD PMID:22206623 Nob1 Mouse 17alpha-ethynylestradiol decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of NOB1 mRNA CTD PMID:29097150 Nob1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NOB1 mRNA CTD PMID:21570461 Nob1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nob1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NOB1 mRNA CTD PMID:33387578 Nob1 Mouse 2,4-dinitrotoluene affects expression ISO Nob1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of NOB1 mRNA CTD PMID:21346803 Nob1 Mouse 2,6-dinitrotoluene affects expression ISO Nob1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of NOB1 mRNA CTD PMID:21346803 Nob1 Mouse 3-chloropropane-1,2-diol increases expression ISO Nob1 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of NOB1 protein CTD PMID:34915118 Nob1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of NOB1 mRNA CTD PMID:39298647 Nob1 Mouse 6-propyl-2-thiouracil decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of NOB1 mRNA CTD PMID:30047161 Nob1 Mouse all-trans-retinoic acid decreases expression ISO NOB1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NOB1 mRNA CTD PMID:33167477 Nob1 Mouse amitrole decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of NOB1 mRNA CTD PMID:30047161 Nob1 Mouse aristolochic acid A increases expression ISO NOB1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NOB1 mRNA CTD PMID:33212167 Nob1 Mouse arsane multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse arsenic atom multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NOB1 mRNA CTD PMID:22228805 Nob1 Mouse benzo[a]pyrene decreases methylation ISO NOB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NOB1 promoter CTD PMID:27901495 Nob1 Mouse beta-lapachone increases expression ISO NOB1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of NOB1 mRNA CTD PMID:38218311 Nob1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of NOB1 mRNA CTD PMID:34319233 Nob1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NOB1 mRNA CTD PMID:26063408 Nob1 Mouse bisphenol A decreases expression ISO Nob1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of NOB1 mRNA CTD PMID:32145629 Nob1 Mouse bisphenol A increases expression ISO Nob1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NOB1 mRNA CTD PMID:25181051 more ... Nob1 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of NOB1 mRNA CTD PMID:38685157 Nob1 Mouse caffeine affects phosphorylation ISO NOB1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of NOB1 protein CTD PMID:35688186 Nob1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of NOB1 mRNA CTD PMID:25554681 Nob1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of NOB1 mRNA CTD PMID:37019170 Nob1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NOB1 gene CTD PMID:20938992 Nob1 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of NOB1 mRNA CTD PMID:28472532 Nob1 Mouse cisplatin increases phosphorylation EXP 6480464 Cisplatin results in increased phosphorylation of NOB1 protein CTD PMID:22006019 Nob1 Mouse clofibric acid multiple interactions ISO Nob1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NOB1 mRNA CTD PMID:17602206 Nob1 Mouse clotrimazole decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Clotrimazole results in decreased expression of NOB1 mRNA CTD PMID:30047161 Nob1 Mouse coumarin increases phosphorylation ISO NOB1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of NOB1 protein CTD PMID:35688186 Nob1 Mouse cyclosporin A increases expression ISO NOB1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NOB1 mRNA CTD PMID:25562108 Nob1 Mouse cylindrospermopsin increases expression ISO NOB1 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of NOB1 mRNA CTD PMID:24921660 Nob1 Mouse Dibutyl phosphate affects expression ISO NOB1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NOB1 mRNA CTD PMID:37042841 Nob1 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of NOB1 mRNA CTD PMID:30529165 Nob1 Mouse diuron increases expression ISO Nob1 (Rattus norvegicus) 6480464 Diuron results in increased expression of NOB1 mRNA CTD PMID:21551480 Nob1 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of NOB1 mRNA CTD PMID:30319688 Nob1 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NOB1 gene CTD PMID:20938992 Nob1 Mouse FR900359 increases phosphorylation ISO NOB1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of NOB1 protein CTD PMID:37730182 Nob1 Mouse gentamycin increases expression ISO Nob1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of NOB1 mRNA CTD PMID:33387578 Nob1 Mouse ivermectin decreases expression ISO NOB1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NOB1 protein CTD PMID:32959892 Nob1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NOB1 gene CTD PMID:20938992 Nob1 Mouse manganese atom multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse manganese(0) multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse manganese(II) chloride multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse N-nitrosodiethylamine multiple interactions ISO Nob1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NOB1 mRNA CTD PMID:17602206 Nob1 Mouse N-nitrosodiethylamine increases expression ISO Nob1 (Rattus norvegicus) 6480464 Diethylnitrosamine results in increased expression of NOB1 mRNA CTD PMID:19041683 Nob1 Mouse okadaic acid decreases expression ISO NOB1 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of NOB1 mRNA CTD PMID:38832940 Nob1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of NOB1 mRNA CTD PMID:17562736 Nob1 Mouse paraquat increases expression ISO Nob1 (Rattus norvegicus) 6480464 Paraquat results in increased expression of NOB1 mRNA CTD PMID:32680482 Nob1 Mouse perfluorononanoic acid increases expression ISO NOB1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of NOB1 mRNA CTD PMID:32588087 Nob1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NOB1 mRNA CTD PMID:36331819 Nob1 Mouse phenobarbital affects expression ISO NOB1 (Homo sapiens) 6480464 Phenobarbital affects the expression of NOB1 mRNA CTD PMID:19159669 Nob1 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of NOB1 mRNA CTD PMID:19710929 Nob1 Mouse potassium chromate increases expression ISO NOB1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of NOB1 mRNA CTD PMID:22079256 Nob1 Mouse potassium chromate multiple interactions ISO NOB1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NOB1 mRNA CTD PMID:22079256 Nob1 Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of NOB1 mRNA CTD PMID:28903501 Nob1 Mouse rotenone decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of NOB1 mRNA CTD PMID:19013527 Nob1 Mouse sodium arsenite multiple interactions ISO NOB1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of NOB1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of NOB1 mRNA CTD PMID:39836092 Nob1 Mouse sodium arsenite decreases expression ISO NOB1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NOB1 mRNA and sodium arsenite results in decreased expression of NOB1 protein CTD PMID:30528433 and PMID:38568856 Nob1 Mouse sulfadimethoxine decreases expression ISO Nob1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of NOB1 mRNA CTD PMID:30047161 Nob1 Mouse sunitinib increases expression ISO NOB1 (Homo sapiens) 6480464 Sunitinib results in increased expression of NOB1 mRNA CTD PMID:31533062 Nob1 Mouse tetrachloromethane multiple interactions ISO Nob1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of NOB1 mRNA] CTD PMID:31150632 Nob1 Mouse tetrachloromethane increases expression ISO Nob1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of NOB1 mRNA CTD PMID:31150632 Nob1 Mouse thapsigargin increases expression ISO Nob1 (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of NOB1 protein CTD PMID:35544339 Nob1 Mouse thioacetamide increases expression ISO Nob1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of NOB1 mRNA CTD PMID:23411599 and PMID:34492290 Nob1 Mouse thiram decreases expression ISO NOB1 (Homo sapiens) 6480464 Thiram results in decreased expression of NOB1 mRNA CTD PMID:38568856 Nob1 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of NOB1 mRNA CTD PMID:29264374 Nob1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of NOB1 gene and titanium dioxide results in decreased methylation of NOB1 promoter CTD PMID:35295148 Nob1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of NOB1 mRNA CTD PMID:17292431 Nob1 Mouse valproic acid decreases expression ISO NOB1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NOB1 mRNA CTD PMID:23179753 Nob1 Mouse valproic acid affects expression ISO NOB1 (Homo sapiens) 6480464 Valproic Acid affects the expression of NOB1 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) caffeine (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) choline (EXP) chromium(6+) (EXP) cisplatin (EXP) clofibric acid (ISO) clotrimazole (ISO) coumarin (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) Dibutyl phosphate (ISO) dioxygen (EXP) diuron (ISO) ethanol (EXP) folic acid (EXP) FR900359 (ISO) gentamycin (ISO) ivermectin (ISO) L-methionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) N-nitrosodiethylamine (ISO) okadaic acid (ISO) paracetamol (EXP) paraquat (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (ISO) pirinixic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) rotenone (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) sunitinib (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) valproic acid (EXP,ISO)
1.
Nob1p is required for cleavage of the 3' end of 18S rRNA.
Fatica A, etal., Mol Cell Biol 2003 Mar;23(5):1798-807.
2.
Up-regulation of Nob1 in the rat auditory system with noise-induced hearing loss.
Han Y, etal., Neurosci Lett. 2011 Mar 10;491(1):79-82. doi: 10.1016/j.neulet.2011.01.010. Epub 2011 Jan 8.
3.
An overview of pre-ribosomal RNA processing in eukaryotes.
Henras AK, etal., Wiley Interdiscip Rev RNA. 2015 Mar-Apr;6(2):225-42. doi: 10.1002/wrna.1269. Epub 2014 Oct 27.
4.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Both endonucleolytic and exonucleolytic cleavage mediate ITS1 removal during human ribosomal RNA processing.
Sloan KE, etal., J Cell Biol. 2013 Mar 4;200(5):577-88. doi: 10.1083/jcb.201207131. Epub 2013 Feb 25.
10.
CK1delta and CK1epsilon are components of human 40S subunit precursors required for cytoplasmic 40S maturation.
Zemp I, etal., J Cell Sci. 2014 Mar 15;127(Pt 6):1242-53. doi: 10.1242/jcs.138719. Epub 2014 Jan 14.
Nob1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 108,139,121 - 108,151,670 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 108,139,118 - 108,151,683 (-) Ensembl GRCm39 Ensembl GRCm38 8 107,412,489 - 107,425,038 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 107,412,486 - 107,425,051 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 109,936,389 - 109,948,938 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 110,301,618 - 110,314,167 (-) NCBI MGSCv36 mm8 Celera 8 111,643,138 - 111,655,687 (-) NCBI Celera Cytogenetic Map 8 D3 NCBI cM Map 8 54.12 NCBI
NOB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 69,741,871 - 69,754,926 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 69,741,871 - 69,754,926 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 69,775,774 - 69,788,829 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 68,333,275 - 68,346,330 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 16 54,290,520 - 54,303,578 (-) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 55,654,088 - 55,667,425 (-) NCBI HuRef CHM1_1 16 71,183,740 - 71,196,858 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 75,544,399 - 75,557,460 (-) NCBI T2T-CHM13v2.0
Nob1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 52,232,543 - 52,245,824 (-) NCBI GRCr8 mRatBN7.2 19 35,322,803 - 35,335,354 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 35,322,669 - 35,346,815 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 42,138,262 - 42,150,724 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 42,791,623 - 42,804,085 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 45,097,502 - 45,109,814 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 38,397,466 - 38,409,924 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 38,397,466 - 38,409,924 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 49,267,159 - 49,279,617 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 37,278,326 - 37,290,784 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 37,283,206 - 37,295,665 (-) NCBI Celera 19 34,744,223 - 34,756,681 (-) NCBI Celera Cytogenetic Map 19 q12 NCBI
Nob1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 6,996,797 - 7,006,164 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 6,996,795 - 7,006,499 (+) NCBI ChiLan1.0 ChiLan1.0
NOB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 79,292,957 - 79,305,907 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 85,205,139 - 85,217,829 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 50,122,905 - 50,135,096 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 69,506,425 - 69,517,932 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 69,506,425 - 69,517,932 (-) Ensembl panpan1.1 panPan2
NOB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 79,958,145 - 79,966,166 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 79,945,446 - 79,966,147 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 79,946,907 - 79,955,072 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 80,388,489 - 80,396,668 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 80,388,557 - 80,396,894 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 80,216,290 - 80,224,456 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 79,905,807 - 79,913,960 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 80,538,734 - 80,546,900 (+) NCBI UU_Cfam_GSD_1.0
Nob1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 39,780,952 - 39,792,829 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 19,796,296 - 19,808,152 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 19,794,199 - 19,808,142 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NOB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 17,233,858 - 17,245,451 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 17,233,863 - 17,245,451 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 16,181,508 - 16,193,098 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NOB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 57,646,386 - 57,661,014 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 57,646,587 - 57,662,406 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 20,377,675 - 20,390,841 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nob1
.
Predicted Target Of
Count of predictions: 1216 Count of miRNA genes: 544 Interacting mature miRNAs: 665 Transcripts: ENSMUST00000003946, ENSMUST00000076585, ENSMUST00000109273, ENSMUST00000163757, ENSMUST00000163973, ENSMUST00000165266, ENSMUST00000169311, ENSMUST00000170796 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300560 Tgl1_m triglyceride level 1 (mouse) Not determined 8 102486208 111650036 Mouse 4141435 Fbtq3_m femoral bone trait QTL 3 (mouse) Not determined 8 100965309 130127694 Mouse 11252141 Fdr2_m fat response to dietary restriction 2 (mouse) 8 98390634 130127694 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1302105 Im1_m Immunoregulatory 1 (mouse) Not determined 8 99828531 130127694 Mouse 1301080 Sluc9_m susceptibility to lung cancer 9 (mouse) Not determined 8 99828531 130127694 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 14746994 Manh65_m mandible shape 65 (mouse) 8 106489629 130127694 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 1301316 Dntcs1_m dental caries susceptibility 1 (mouse) Not determined 8 103443553 127781786 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 1300681 Pgia22_m proteoglycan induced arthritis 22 (mouse) Not determined 8 102486208 116025457 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1357494 Obsty2_m obesity 2 (mouse) Not determined 8 96245241 129745061 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 12880431 Fgf23lq2_m FGF23 serum level QTL 2 (mouse) 8 97626632 130127694 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1301481 Lith11_m lithogenic gene 11 (mouse) Not determined 8 98563635 130127694 Mouse 11532692 Sluc38a_m susceptibility to lung cancer 38a (mouse) 8 105033977 130127694 Mouse 11532691 Sluc38_m susceptibility to lung cancer 38 (mouse) 8 105033977 130127694 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000003946 ⟹ ENSMUSP00000003946
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,139,121 - 108,151,681 (-) Ensembl GRCm38.p6 Ensembl 8 107,412,489 - 107,425,049 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000076585
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,144,688 - 108,148,959 (-) Ensembl GRCm38.p6 Ensembl 8 107,418,056 - 107,422,327 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000109273
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,144,786 - 108,145,298 (-) Ensembl GRCm38.p6 Ensembl 8 107,418,154 - 107,418,666 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000163757
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,142,870 - 108,151,618 (-) Ensembl GRCm38.p6 Ensembl 8 107,416,238 - 107,424,986 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000163973
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,144,327 - 108,151,683 (-) Ensembl GRCm38.p6 Ensembl 8 107,417,695 - 107,425,051 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000165266 ⟹ ENSMUSP00000129298
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,144,982 - 108,151,658 (-) Ensembl GRCm38.p6 Ensembl 8 107,418,350 - 107,425,026 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000169311 ⟹ ENSMUSP00000126868
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,139,118 - 108,151,673 (-) Ensembl GRCm38.p6 Ensembl 8 107,412,486 - 107,425,041 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000170796
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 108,139,118 - 108,148,194 (-) Ensembl GRCm38.p6 Ensembl 8 107,412,486 - 107,421,562 (-) Ensembl
RefSeq Acc Id:
NM_026277 ⟹ NP_080553
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 108,139,121 - 108,151,670 (-) NCBI GRCm38 8 107,412,489 - 107,425,038 (-) ENTREZGENE MGSCv37 8 109,936,389 - 109,948,938 (-) RGD Celera 8 111,643,138 - 111,655,687 (-) RGD cM Map 8 ENTREZGENE
Sequence:
GACAGCCAACATGGCGCCGGTGGAGCACGTTGTGGCTGATGCCGGAGCTTTCTTGAGGGACGCGCCTCTGCAGGACATCGGGAAGAACATCTACACCATCCGGGAGGTGGTGCGAGAGATTCGCGACA
hide sequence
RefSeq Acc Id:
NP_080553 ⟸ NM_026277
- UniProtKB:
Q7TPR3 (UniProtKB/Swiss-Prot), Q9CRD7 (UniProtKB/Swiss-Prot), Q8BW10 (UniProtKB/Swiss-Prot), Q148S3 (UniProtKB/TrEMBL)
- Sequence:
MAPVEHVVADAGAFLRDAPLQDIGKNIYTIREVVREIRDKATRRRLAVLPYQLRFKEPLPEYVRLVTEFSKKTGDYPSLSATDIQVLALTYQLEAEFVGVSHLKKEPEKAKVSSSIQHPETALHISGF
hide sequence
Ensembl Acc Id:
ENSMUSP00000129298 ⟸ ENSMUST00000165266
Ensembl Acc Id:
ENSMUSP00000126868 ⟸ ENSMUST00000169311
Ensembl Acc Id:
ENSMUSP00000003946 ⟸ ENSMUST00000003946
RGD ID: 8668215 Promoter ID: EPDNEW_M12139 Type: multiple initiation site Name: Nob1_1 Description: Mus musculus NIN1/RPN12 binding protein 1 homolog , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 107,425,038 - 107,425,098 EPDNEW
RGD ID: 6843553 Promoter ID: MM_KWN:55661 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000003946, UC009NHS.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 109,948,631 - 109,949,131 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-29
Nob1
NIN1/RPN12 binding protein 1 homolog
NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)
Symbol and/or name change
5135510 APPROVED
