Advanced Search (OLGA)

Gene: Spink4 (serine peptidase inhibitor, Kazal type 4) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Spink4

Name:

serine peptidase inhibitor, Kazal type 4

RGD ID:

1553095

MGI Page

MGI

Description:

Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be located in extracellular region. Is expressed in brain ventricular layer; ganglia; liver lobe; and olfactory epithelium. Orthologous to human SPINK4 (serine peptidase inhibitor Kazal type 4).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MPGC6; MPGC60; peptide PEC-60 homolog; serine protease inhibitor Kazal-type 4; serine protease inhibitor, Kazal type 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	40,920,056 - 40,931,395 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	40,920,056 - 40,931,395 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	40,867,089 - 40,878,428 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	41,095,937 - 41,143,924 (+)	NCBI		MGSCv36	mm8
Celera	4	40,580,572 - 40,591,997 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	20.64	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spink4	Mouse	acromesomelic dysplasia, Maroteaux type		ISO	SPINK4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Acromesomelic dysplasia 1 and Maroteaux type	ClinVar	PMID:28492532
Spink4	Mouse	distal arthrogryposis type 1A		ISO	SPINK4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Arthrogryposis more ...	ClinVar	PMID:28492532
Spink4	Mouse	frontotemporal dementia and/or amyotrophic lateral sclerosis 6		ISO	SPINK4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Frontotemporal dementia and/or amyotrophic lateral sclerosis 6	ClinVar	PMID:28492532
Spink4	Mouse	galactosemia		ISO	SPINK4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of UDPglucose-hexose-1-phosphate uridylyltransferase	ClinVar	PMID:28492532
Spink4	Mouse	primary ciliary dyskinesia		ISO	SPINK4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spink4	Mouse	1,2-dimethylhydrazine	multiple interactions	ISO	Spink4 (Rattus norvegicus)	6480464	[APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of SPINK4 mRNA	CTD	PMID:27840820
Spink4	Mouse	1,2-dimethylhydrazine	increases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in increased expression of SPINK4 mRNA	CTD	PMID:22206623
Spink4	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SPINK4 mRNA]	CTD	PMID:22206623
Spink4	Mouse	17beta-estradiol	increases expression	ISO	SPINK4 (Homo sapiens)	6480464	Estradiol results in increased expression of SPINK4 mRNA	CTD	PMID:25321415
Spink4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SPINK4 mRNA	CTD	PMID:21570461
Spink4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SPINK4 mRNA	CTD	PMID:33387578
Spink4	Mouse	5-fluorouracil	affects expression	ISO	SPINK4 (Homo sapiens)	6480464	Fluorouracil affects the expression of SPINK4 mRNA	CTD	PMID:16584549
Spink4	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of SPINK4 mRNA	CTD	PMID:22504374
Spink4	Mouse	acrylamide	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Acrylamide results in increased expression of SPINK4 mRNA	CTD	PMID:28959563
Spink4	Mouse	Benzo[k]fluoranthene	increases expression	EXP		6480464	benzo(k)fluoranthene results in increased expression of SPINK4 mRNA	CTD	PMID:26377693
Spink4	Mouse	bis(2-ethylhexyl) phthalate	decreases expression	EXP		6480464	Diethylhexyl Phthalate results in decreased expression of SPINK4 mRNA	CTD	PMID:32235866
Spink4	Mouse	bisphenol A	decreases expression	ISO	Spink4 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of SPINK4 mRNA	CTD	PMID:25181051
Spink4	Mouse	bisphenol A	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	bisphenol A results in decreased expression of SPINK4 mRNA	CTD	PMID:31715268
Spink4	Mouse	butanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	butyraldehyde results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	cadmium dichloride	decreases methylation	ISO	Spink4 (Rattus norvegicus)	6480464	Cadmium Chloride results in decreased methylation of SPINK4 promoter	CTD	PMID:22457795
Spink4	Mouse	cadmium dichloride	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of SPINK4 mRNA	CTD	PMID:38382870
Spink4	Mouse	carbon nanotube	decreases expression	EXP		6480464	Nanotubes and Carbon results in decreased expression of SPINK4 mRNA	CTD	PMID:25554681
Spink4	Mouse	copper atom	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of SPINK4 mRNA	CTD	PMID:26033743
Spink4	Mouse	copper(0)	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of SPINK4 mRNA	CTD	PMID:26033743
Spink4	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of SPINK4 mRNA	CTD	PMID:17361019 and PMID:21266533
Spink4	Mouse	diethylstilbestrol	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Diethylstilbestrol results in increased expression of SPINK4 mRNA	CTD	PMID:17005392
Spink4	Mouse	folic acid	multiple interactions	EXP		6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SPINK4 mRNA]	CTD	PMID:22206623
Spink4	Mouse	furan	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	furan results in increased expression of SPINK4 mRNA	CTD	PMID:27387713
Spink4	Mouse	heptanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	heptanal results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	hexanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	n-hexanal results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	hydroquinone	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	hydroquinone results in decreased expression of SPINK4 mRNA	CTD	PMID:31256213
Spink4	Mouse	hydroxyurea	increases mutagenesis	EXP		6480464	Hydroxyurea results in increased mutagenesis of SPINK4 gene	CTD	PMID:16868089
Spink4	Mouse	lead diacetate	decreases expression	ISO	Spink4 (Rattus norvegicus)	6480464	lead acetate results in decreased expression of SPINK4 mRNA	CTD	PMID:22641619
Spink4	Mouse	malathion	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	Malathion results in decreased expression of SPINK4 mRNA	CTD	PMID:37047231
Spink4	Mouse	methimazole	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Methimazole results in increased expression of SPINK4 mRNA	CTD	PMID:22504374
Spink4	Mouse	N-methyl-4-phenylpyridinium	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of SPINK4 mRNA	CTD	PMID:28801915
Spink4	Mouse	N-methyl-N-nitrosourea	increases mutagenesis	EXP		6480464	Methylnitrosourea results in increased mutagenesis of SPINK4 gene	CTD	PMID:16868089
Spink4	Mouse	nonanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	nonanal results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	octanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	caprylic aldehyde results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	paracetamol	decreases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of SPINK4 mRNA	CTD	PMID:33387578
Spink4	Mouse	pentanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	pentanal results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of SPINK4 mRNA	CTD	PMID:17426115
Spink4	Mouse	potassium dichromate	decreases expression	EXP		6480464	Potassium Dichromate results in decreased expression of SPINK4 mRNA	CTD	PMID:23608068
Spink4	Mouse	propanal	increases methylation	ISO	SPINK4 (Homo sapiens)	6480464	propionaldehyde results in increased methylation of SPINK4 gene	CTD	PMID:30002397
Spink4	Mouse	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of SPINK4 mRNA	CTD	PMID:16014739
Spink4	Mouse	tetrachloromethane	decreases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in decreased expression of SPINK4 mRNA	CTD	PMID:33387578
Spink4	Mouse	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of SPINK4 mRNA	CTD	PMID:23557971
Spink4	Mouse	trichloroethene	increases expression	ISO	Spink4 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of SPINK4 mRNA	CTD	PMID:33387578
Spink4	Mouse	vinclozolin	increases methylation	ISO	Spink4 (Rattus norvegicus)	6480464	vinclozolin results in increased methylation of SPINK4 gene	CTD	PMID:31079544
Spink4	Mouse	zinc atom	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	Zinc results in decreased expression of SPINK4 mRNA	CTD	PMID:15984569
Spink4	Mouse	zinc(0)	decreases expression	ISO	SPINK4 (Homo sapiens)	6480464	Zinc results in decreased expression of SPINK4 mRNA	CTD	PMID:15984569

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spink4	Mouse	response to xenobiotic stimulus		ISO	Spink4 (Rattus norvegicus)	9068941		RGD	PMID:1772043 and REF_RGD_ID:2317002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spink4	Mouse	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	2290270		UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spink4	Mouse	protein binding	enables	ISO	UniProtKB:Q96EQ0	9068941	PMID:32296183	IntAct	PMID:32296183
Spink4	Mouse	serine-type endopeptidase inhibitor activity	enables	IEA	UniProtKB-KW:KW-0722	2290270		UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9810707	PMID:12477932	PMID:14610273	PMID:16602821	PMID:17062627	PMID:18554416	PMID:19549527	PMID:20562862	PMID:21267068	PMID:37013514	PMID:38997284

Spink4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	40,920,056 - 40,931,395 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	40,920,056 - 40,931,395 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	40,867,089 - 40,878,428 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	41,095,937 - 41,143,924 (+)	NCBI		MGSCv36	mm8
Celera	4	40,580,572 - 40,591,997 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	20.64	NCBI

SPINK4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	33,240,167 - 33,248,567 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	33,218,365 - 33,248,567 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	33,240,165 - 33,248,565 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	33,230,196 - 33,238,565 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	33,230,195 - 33,238,564	NCBI
Celera	9	33,170,395 - 33,178,768 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	33,197,153 - 33,205,532 (+)	NCBI		HuRef
CHM1_1	9	33,239,128 - 33,247,497 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	33,258,882 - 33,267,284 (+)	NCBI		T2T-CHM13v2.0

Spink4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	60,811,899 - 60,860,823 (+)	NCBI		GRCr8
mRatBN7.2	5	56,043,936 - 56,064,841 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	55,981,624 - 56,064,795 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	58,010,977 - 58,031,900 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	59,830,126 - 59,851,051 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	59,824,235 - 59,845,122 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	57,238,221 - 57,252,654 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	57,239,086 - 57,250,662 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	61,770,297 - 61,782,009 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	58,314,305 - 58,325,973 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	58,314,483 - 58,326,152 (+)	NCBI
Celera	5	54,664,999 - 54,676,599 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

Spink4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	2,406,279 - 2,415,668 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	2,406,279 - 2,415,668 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPINK4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	91,353,771 - 91,358,753 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	91,359,713 - 91,364,695 (-)	NCBI		NHGRI_mPanPan1

SPINK4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	50,340,068 - 50,345,777 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	50,340,145 - 50,345,777 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	48,967,880 - 48,975,762 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	51,277,984 - 51,285,866 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	51,278,074 - 51,285,866 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	49,942,377 - 49,950,251 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	49,809,310 - 49,817,196 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	50,574,406 - 50,582,288 (+)	NCBI		UU_Cfam_GSD_1.0

Spink4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	165,237,296 - 165,243,461 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	1,785,415 - 1,790,954 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	1,784,805 - 1,789,464 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPINK4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	33,246,247 - 33,255,688 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	33,246,260 - 33,255,617 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	37,503,380 - 37,512,763 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Spink4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	37,998,891 - 38,008,535 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	37,988,002 - 38,010,277 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Spink4
599 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	338
Count of miRNA genes:	260
Interacting mature miRNAs:	286
Transcripts:	ENSMUST00000030122, ENSMUST00000132943
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301203	Alcp8_m	alcohol preference locus 8 (mouse)			Not determined		4	17395160	51395290	Mouse
1301586	Stheal3_m	soft tissue heal 3 (mouse)			Not determined		4	28658442	62658566	Mouse
10401115	Pgia35_m	proteoglycan induced arthritis 35 (mouse)			Not determined		4	12562377	46562509	Mouse
39128211	Lwq22_m	liver weight QTL 22 (mouse)					4	17892616	88982216	Mouse
1558992	Ses8_m	salmonella enteritidis susceptibility 8 (mouse)			Not determined		4	8683240	42683429	Mouse
4141302	Ssrq5_m	stress response QTL 5 (mouse)			Not determined			8683240	42683430	Mouse
4141555	Nbwa2_m	NZB and NZW autoimmunity 2 (mouse)			Not determined		4	17892515	51892635	Mouse
10412178	Habiir2_m	hyperoxic acute lung injury imprinted region 2 (mouse)			Not determined		4	39452126	63283678	Mouse
1300574	Im2_m	immunoregulatory 2 (mouse)			Not determined		4	28077682	62077816	Mouse
12880405	Jcdq1_m	joint cartilage degeneration QTL 1 (mouse)					4	12562377	46562509	Mouse
4142318	Lyr2_m	lymphoma resistance 2 (mouse)			Not determined			14010457	63283678	Mouse
1301697	Sluc18_m	susceptibility to lung cancer 18 (mouse)			Not determined		4	22373448	56373612	Mouse
1357453	Kidq4_m	kidney weight QTL 4 (mouse)			Not determined		4	17892616	88982216	Mouse
4142047	Mvwf3_m	modifier of von Willebrand factor 3 (mouse)			Not determined			14010457	117072206	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
1357877	Synch1_m	synechia 1 (mouse)			Not determined		4	28709925	62710107	Mouse
1300977	Mopkd1_m	modifier of polycystic kidney disease progression 1 (mouse)			Not determined		4	36550839	70550967	Mouse
25440481	Moaq1_m	modifier of alien QTL 1 (mouse)					4	19500000	46000000	Mouse
1301237	Alcp7_m	alcohol preference locus 7 (mouse)			Not determined		4	17395160	51395290	Mouse
4141911	W6q15_m	weight 6 weeks QTL 15 (mouse)			Not determined			17892616	88982216	Mouse
1302075	Bdln6_m	body length 6 (mouse)			Not determined		4	22373448	56373612	Mouse
1302010	Wta1_m	weight adult 1 (mouse)			Not determined		4	8683240	42683429	Mouse
4142290	Ssrq9_m	stress response QTL 9 (mouse)			Not determined			34395160	46332776	Mouse
1301437	Scon1_m	sucrose consumption 1 (mouse)			Not determined		4	22373448	56373612	Mouse
10401905	Sicd3_m	seizure-induced cell death 3 (mouse)			Not determined		4	9395525	43760862	Mouse
1301473	Triglq1_m	triglyceride QTL 1 (mouse)			Not determined		4	8683240	42683429	Mouse
1300769	Pcyts2_m	plasmacytoma susceptibility 2 (mouse)			Not determined		4	22111944	56112145	Mouse
1301792	Hdlq10_m	HDL QTL 10 (mouse)			Not determined		4	35859707	69859853	Mouse
1301990	Arvm1_m	autoimmune renal vasculitis 1 (mouse)			Not determined		4	29332646	63332776	Mouse
1302116	Bbaa1_m	B.burgdorferi-associated arthritis 1 (mouse)			Not determined		4	38250930	72251078	Mouse
1302058	Hrtfm3_m	heart failure modifier 3 (mouse)			Not determined		4	22111944	56112145	Mouse
1302184	Aaom1_m	autoimmune aoritis in MRL mice 1 (mouse)			Not determined		4	24322299	46332776	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
1302125	Lxw1_m	lupus BXSB x NZW 1 (mouse)			Not determined		4	8683240	42683429	Mouse

D4Mit195

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	40,937,840 - 40,937,943	UniSTS	GRCm38
MGSCv37	4	40,884,873 - 40,884,976	UniSTS	GRCm37
Celera	4	40,598,514 - 40,598,621	UniSTS
Cytogenetic Map	4	A	UniSTS
Cytogenetic Map	4	B1	UniSTS
cM Map	4	12.1	UniSTS
Whitehead Genetic	4	16.4	UniSTS
Whitehead_YAC	4		UniSTS

Bag1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	40,936,446 - 40,936,651	UniSTS	GRCm38
MGSCv37	4	40,883,479 - 40,883,684	UniSTS	GRCm37
Celera	4	40,597,120 - 40,597,325	UniSTS
Cytogenetic Map	4	A	UniSTS
Cytogenetic Map	4	B1	UniSTS
cM Map	UN		UniSTS
cM Map	4		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_011463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL837521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF381698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y11505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000030122 ⟹ ENSMUSP00000030122

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl
GRCm38.p6 Ensembl	4	40,920,052 - 40,931,395 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000132943

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	40,920,054 - 40,925,044 (+)	Ensembl
GRCm38.p6 Ensembl	4	40,920,054 - 40,925,044 (+)	Ensembl

RefSeq Acc Id:

NM_011463 ⟹ NP_035593

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	40,920,056 - 40,931,395 (+)	NCBI
GRCm38	4	40,920,056 - 40,931,395 (+)	ENTREZGENE
MGSCv37	4	40,867,089 - 40,878,428 (+)	RGD
Celera	4	40,580,572 - 40,591,997 (+)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

GGCCCACACTTGACTGCAGTCACATAGCTCACAAGCAGCATGGCTATGCATCTGTGGCTGGTCACCCTGACCTTGGTTCCCCTCCTTGGCATGGACAGGGAACTGATGGTGTCAGCTGGGAGCCTTGT
TTTCCCCAGAATGCCCTTCTGTGAGCACATGGCTGAGCTTCCAAACTGTCCCCAGACACCCAACCTGATCTGTGGCACGGATGGGCTCACATATGAAAATGAATGCCACCTTTGCCTGACCCGGATGA
AAACCATGAAGGACATTCAAATCATGAAGGATGGCCAATGCTGAGCTCAGAGGTGCACTCAAGCCATGAAACTTCATGCTGGAGAACAGTGATGCCCCAGAGGCTATGACATGAAATAAAAGATGCAG
CCCAAGCTAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_035593	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI17049	(Get FASTA)	NCBI Sequence Viewer
	AAI17051	(Get FASTA)	NCBI Sequence Viewer
	CAA72282	(Get FASTA)	NCBI Sequence Viewer
	EDL05424	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000030122
	ENSMUSP00000030122.5
GenBank Protein	O35679	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_035593 ⟸ NM_011463
- Peptide Label:	precursor
- UniProtKB:	Q149Z4 (UniProtKB/Swiss-Prot), O35679 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAMHLWLVTLTLVPLLGMDRELMVSAGSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC hide sequence

Ensembl Acc Id:

ENSMUSP00000030122 ⟸ ENSMUST00000030122

Protein Domains

Kazal-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35679-F1-model_v2	AlphaFold	O35679	1-86	view protein structure

RGD ID:

6883066

Promoter ID:

EPDNEW_M4984

Type:

multiple initiation site

Name:

Spink4_1

Description:

Mus musculus serine peptidase inhibitor, Kazal type 4 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	40,920,056 - 40,920,116	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000028415	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000030122	ENTREZGENE
	ENSMUST00000030122.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.60.30	UniProtKB/Swiss-Prot
InterPro	Kazal_dom	UniProtKB/Swiss-Prot
	Kazal_dom_sf	UniProtKB/Swiss-Prot
	Spink4-like	UniProtKB/Swiss-Prot
KEGG Report	mmu:20731	UniProtKB/Swiss-Prot
MGD	MGI:1341848	ENTREZGENE
NCBI Gene	20731	ENTREZGENE
PANTHER	PTHR21179	UniProtKB/Swiss-Prot
	SERINE PROTEASE INHIBITOR KAZAL-TYPE 4	UniProtKB/Swiss-Prot
Pfam	Kazal_1	UniProtKB/Swiss-Prot
PharmGKB	SPINK4	RGD
PhenoGen	Spink4	PhenoGen
PROSITE	KAZAL_1	UniProtKB/Swiss-Prot
	KAZAL_2	UniProtKB/Swiss-Prot
SMART	KAZAL	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF100895	UniProtKB/Swiss-Prot
UniProt	ISK4_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q149Z4	ENTREZGENE
UniProt Secondary	Q149Z4	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar