Olfr412 (olfactory receptor 412) - Rat Genome Database

Name: Olfr412
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Olfr412 (olfactory receptor 412) Mus musculus

Analyze

Symbol:

Olfr412

Name:

olfactory receptor 412

RGD ID:

1552293

MGI Page

MGI

Description:

Orthologous to several human genes including OR1D2 (olfactory receptor family 1 subfamily D member 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

GA_x6K02T2P1NL-4500587-4501525; MOR127; MOR127-5P; olfactory receptor MOR127-5P

RGD Orthologs

Human

Rat

Dog

Green Monkey

Alliance Genes

More Info

more info ...

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	74,255,497 - 74,256,435 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	11	74,252,895 - 74,257,044 (+)	Ensembl
GRCm38	11	74,364,671 - 74,365,609 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	74,362,069 - 74,366,218 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	74,178,173 - 74,179,111 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	11	74,180,866 - 74,181,804 (+)	NCBI			mm8
Celera	11	81,877,216 - 81,878,154 (+)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

acrylamide (ISO)

aflatoxin B1 (ISO)

bisphenol A (ISO)

cadmium dichloride (ISO)

calcium atom (ISO)

calcium(0) (ISO)

crocidolite asbestos (ISO)

glycidol (ISO)

thalidomide (EXP)

undecanal (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IBA)

G protein-coupled receptor signaling pathway (ISA,ISO)

sensory perception of smell (ISA)

Cellular Component

integral component of membrane (ISA)

Molecular Function

identical protein binding (ISO)

olfactory receptor activity (IBA,ISA,ISO)

References

References - curated


1.	MGD data from the GO Consortium
2.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11170746	PMID:11802173	PMID:11875048	PMID:14611657	PMID:21267068	PMID:21873635

Genomics

Comparative Map Data

Olfr412
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	74,255,497 - 74,256,435 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	11	74,252,895 - 74,257,044 (+)	Ensembl
GRCm38	11	74,364,671 - 74,365,609 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	74,362,069 - 74,366,218 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	74,178,173 - 74,179,111 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	11	74,180,866 - 74,181,804 (+)	NCBI			mm8
Celera	11	81,877,216 - 81,878,154 (+)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI

OR1D2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	17	3,088,484 - 3,104,422 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	17	3,088,484 - 3,104,422 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	17	2,991,778 - 3,007,716 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	2,942,102 - 2,943,040 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	17	2,942,101 - 2,943,040	NCBI
Celera	17	3,013,570 - 3,014,508 (-)	NCBI
Cytogenetic Map	17	p13.3	ENTREZGENE
HuRef	17	2,887,600 - 2,888,538 (-)	NCBI		HuRef
CHM1_1	17	3,004,202 - 3,005,140 (-)	NCBI		CHM1_1

Olr1519
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	59,212,947 - 59,213,882 (+)	NCBI
Rnor_6.0 Ensembl	10	61,152,379 - 61,153,198 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	10	61,160,125 - 61,161,060 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	10	61,160,125 - 61,161,060 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
RGSC_v3.4	10	61,632,798 - 61,633,733 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	10	61,646,420 - 61,647,356 (+)	NCBI
Celera	10	58,245,853 - 58,246,788 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

OR1D10P
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	9	47,061,492 - 47,062,498 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	9	47,061,492 - 47,062,546 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

LOC103242147
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	2,754,981 - 2,766,197 (+)	NCBI
ChlSab1.1 Ensembl	16	2,765,210 - 2,766,148 (+)	Ensembl

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
13208559	Wght10_m	weight 10 (mouse)					11	4000000	89000000	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	4000000	95000000	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6930277	89128908	Mouse
1357859	Lvrq7_m	liver weight QTL 7 (mouse)			Not determined		11	12318637	118131898	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12318637	118131898	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19174204	97007000	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21857364	95990405	Mouse
13208569	Bmiq10_m	body mass index QTL 10 (mouse)					11	36000000	85000000	Mouse
1301328	Mol4_m	modifier of LPS-response 4 (mouse)			Not determined		11	36391750	83590530	Mouse
11532698	Sluc36a_m	susceptibility to lung cancer 36a (mouse)					11	42365791	76365904	Mouse
11532699	Sluc36b_m	susceptibility to lung cancer 36b (mouse)					11	42365791	76365904	Mouse
4142300	Ctrq3_m	C. trachomatis resistance QTL 3 (mouse)			Not determined		11	44739211	76963931	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44739211	113167183	Mouse
4141000	Nidd3_m	non-insulin-dependent diabetes mellitus 3 (mouse)			Not determined			45151201	79151308	Mouse
1302021	Nidd1n_m	non-insulin-dependent diabetes mellitus 1 in NSY (mouse)			Not determined		11	45275046	80087498	Mouse
1357878	Mastr_m	modifier of astrocytoma (mouse)			Not determined		11	45817754	89927907	Mouse
1300765	Bbaa4_m	B.burgdorferi-associated arthritis 4 (mouse)			Not determined		11	46294341	80294436	Mouse
1301988	Bmd11_m	bone mineral density 11 (mouse)			Not determined		11	46428581	80428696	Mouse
1301830	Ssta4_m	susceptibility to Salmonella typhimurium antigens 4 (mouse)			Not determined		11	50187365	84187585	Mouse
13524840	Ppiq9a_m	prepulse inhibition QTL 9a (mouse)					11	52603559	86603559	Mouse
1300774	Pgia7_m	proteoglycan induced arthritis 7 (mouse)			Not determined		11	53499762	87499911	Mouse
4141830	Pregq1_m	pregnancy QTL 1 (mouse)			Not determined		11	54235926	83842826	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56973201	114267131	Mouse
1300664	Etohcta9_m	ethanol conditioned taste aversion 9 (mouse)			Not determined		11	57863834	91863932	Mouse
10053682	Eae45_m	experimental allergic encephalomyelitis susceptibility 45 (mouse)			Not determined		11	58599729	74863932	Mouse
1300924	Ity2_m	immunity to S. typhimurium 2 (mouse)			Not determined		1	58617204	87804412	Mouse
4141982	Skts-fp2_m	skin tumor susceptibility in FVB and PWK 2 (mouse)			Not determined			58828440	85175703	Mouse
1301987	Pid3_m	prior incubation determinant 3 (mouse)			Not determined		11	61795994	88808902	Mouse
1301319	Dautb4_m	dopamine uptake transporter binding 4 (mouse)			Not determined		11	62265179	96265327	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62700000	109500000	Mouse
1301999	Lmr15_m	leishmaniasis resistance 15 (mouse)			Not determined		11	63428581	81939647	Mouse
10044004	Stzid3_m	streptozotocin induced diabetes susceptibility 3 (mouse)			Not determined		11	63428581	94173092	Mouse
11039501	Ltpr6a_m	Leishmania tropica response 6a (mouse)					11	64939510	98939647	Mouse
11039502	Ltpr6b_m	Leishmania tropica response 6b (mouse)					11	64939510	98939647	Mouse
11039515	Ltpr6_m	Leishmania tropica response 6 (mouse)					11	64939510	98939647	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66842594	100842826	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66842594	100842826	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66842594	100842826	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66842594	100842826	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66842594	100842826	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66842594	100842826	Mouse
4142316	Ity2b_m	immunity to S. typhimurium 2b (mouse)			Not determined		11	67187365	79923086	Mouse
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68300000	102000000	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70800372	104800540	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70800372	104800540	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70800372	104800540	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70800372	104800540	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72128823	106128908	Mouse
1301078	Alcp2_m	alcohol preference locus 2 (mouse)			Not determined		11	72318970	84840636	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72835299	106835463	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72927789	106927907	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72927789	106927907	Mouse
12903994	Opfaq3_m	open field activity QTL 3 (mouse)					11	73846715	82178599	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	89
Count of miRNA genes:	85
Interacting mature miRNAs:	89
Transcripts:	ENSMUST00000077794
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF309122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL604065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY073943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY317517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU207308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000077794 ⟹ ENSMUSP00000076967

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	11	74,364,671 - 74,365,609 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000216362 ⟹ ENSMUSP00000149922

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	11	74,362,069 - 74,366,218 (+)	Ensembl

RefSeq Acc Id:

NM_001011851 ⟹ NP_001011851

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	74,255,497 - 74,256,435 (+)	NCBI
GRCm38	11	74,364,671 - 74,365,609 (+)	ENTREZGENE
MGSCv37	11	74,178,173 - 74,179,111 (+)	RGD
Celera	11	81,877,216 - 81,878,154 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

ATGGACGGAGGCAACCAGAGTGGGGACTCTGAGTTCCTCCTCCTGGGACTCTCGGAGGTTCCTG
AGCATCAGCGCATCCTATTCTGGACCTTCCTGTCCATGTACCTGGTCACAGTGGTGGGGAACGT
GCTCATCATCCTGGCCATTGGCTCTGACTCGCACCTGCACACTCCCATGTATTTCTTCCTGGCC
AACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACTATCCCCAAGATGCTGGTGAGCCTTC
AATCCCAGAACAAAGCTATCTCCTATCCAGGATGTCTGACACAGCTCTTCTTCCTGGTGTCTTT
GGTAGCCTTGGACAATCTCATCCTGGCTGTAATGGCATATGACCGTTATGTGGCCATCTGTCAC
CCCCTCCATTACACTACAGCCATGAGTCCCAAGCTCTGTATCTTACTTCTCATCTTGTGCTGGG
CCCTATCTATCCTTTATGGCCTCATCCACACCCTCCTCATGACCAGAGTAACCTTCTGTGGGTC
TCGGAAAATCCACTACATCTTCTGCGAAATGTATGTCCTGCTGAGGCTTGCATGCTCTAACACC
CACATCAATCACATGATGCTGATCGCCACGGGCTGCTTCGTCTTCCTTGTTCCTTTTGGATTCA
TGATCATGTCCTATATCTGCATTGTCAGAGCTATCCTCAAAATTCCTTCAGCCTCTAACAAGTA
CAAAGCCTTTTCCACCTGTGCGTCCCATCTGGCTGTGGTGGCCCTCTTCTATGGGACACTGTGT
ATGGTGTATCTGAAACCCCTGCACACCTACTCCATGAAAGACTCAGTAGCCACTGTGATGTATG
CAGTGGTGACACCCATGATGAACCCTTTCATCTACAGCCTGAGGAACAAGGACATGCACGGGGC
TCTGGGAAGACTGCTAAGGAAGCCACTTCAGAAGCTAACATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001011851	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG42793	(Get FASTA)	NCBI Sequence Viewer
	AAP70934	(Get FASTA)	NCBI Sequence Viewer
	EDL12770	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001011851 ⟸ NM_001011851

- UniProtKB:

Q7TRW7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDGGNQSGDSEFLLLGLSEVPEHQRILFWTFLSMYLVTVVGNVLIILAIGSDSHLHTPMYFFLA
NLSFTDLFFVTNTIPKMLVSLQSQNKAISYPGCLTQLFFLVSLVALDNLILAVMAYDRYVAICH
PLHYTTAMSPKLCILLLILCWALSILYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRLACSNT
HINHMMLIATGCFVFLVPFGFMIMSYICIVRAILKIPSASNKYKAFSTCASHLAVVALFYGTLC
MVYLKPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLRKPLQKLT

hide sequence

RefSeq Acc Id:

ENSMUSP00000149922 ⟸ ENSMUST00000216362

RefSeq Acc Id:

ENSMUSP00000076967 ⟸ ENSMUST00000077794

Protein Domains

G_PROTEIN_RECEP_F1_2

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:3030246	AgrOrtholog
Ensembl Genes	ENSMUSG00000058275	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000076967	ENTREZGENE, UniProtKB/TrEMBL
	ENSMUSP00000149922	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000077794	ENTREZGENE, UniProtKB/TrEMBL
	ENSMUST00000216362	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	mmu:258153	UniProtKB/TrEMBL
MGD	MGI:3030246	ENTREZGENE
NCBI Gene	258153	ENTREZGENE
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Olfr412	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
UniProt	Q7TRW7	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)