Symbol:
Or1d2
Name:
olfactory receptor family 1 subfamily D member 2
RGD ID:
1552293
MGI Page
MGI
Description:
Predicted to enable identical protein binding activity and olfactory receptor activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to several human genes including OR1D2 (olfactory receptor family 1 subfamily D member 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GA_x6K02T2P1NL-4500587-4501525; MOR127; MOR127-5P; olfactory receptor 412; olfactory receptor MOR127-5P; Olfr412
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OR1D2 (olfactory receptor family 1 subfamily D member 2)
HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Or1d2 (olfactory receptor family 1 subfamily D member 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100992356 (olfactory receptor 1D2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OR1D10P (olfactory receptor family 1 subfamily D member 10, pseudogene)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103242147 (olfactory receptor 1D2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR1D5 (olfactory receptor family 1 subfamily D member 5)
HGNC
OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):
OR1D4 (olfactory receptor family 1 subfamily D member 4)
HGNC
Panther
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Or1d2 (olfactory receptor family 1 subfamily D member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OR1D5 (olfactory receptor family 1 subfamily D member 5)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Homo sapiens (human):
OR1D4 (olfactory receptor family 1 subfamily D member 4)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Homo sapiens (human):
OR1D2 (olfactory receptor family 1 subfamily D member 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 74,255,497 - 74,256,435 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 74,252,895 - 74,257,044 (+) Ensembl GRCm39 Ensembl GRCm38 11 74,364,671 - 74,365,609 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 74,362,069 - 74,366,218 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 74,178,173 - 74,179,111 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 74,180,866 - 74,181,804 (+) NCBI MGSCv36 mm8 Celera 11 81,877,216 - 81,878,154 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.76 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Or1d2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 74,255,497 - 74,256,435 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 74,252,895 - 74,257,044 (+) Ensembl GRCm39 Ensembl GRCm38 11 74,364,671 - 74,365,609 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 74,362,069 - 74,366,218 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 74,178,173 - 74,179,111 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 74,180,866 - 74,181,804 (+) NCBI MGSCv36 mm8 Celera 11 81,877,216 - 81,878,154 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.76 NCBI
OR1D2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 3,088,484 - 3,104,422 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 3,088,484 - 3,104,422 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 2,991,778 - 3,007,716 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 2,942,102 - 2,943,040 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 2,942,101 - 2,943,040 NCBI Celera 17 3,013,570 - 3,014,508 (-) NCBI Celera Cytogenetic Map 17 p13.3 ENTREZGENE HuRef 17 2,887,600 - 2,888,538 (-) NCBI HuRef CHM1_1 17 3,004,202 - 3,005,140 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 2,976,732 - 2,992,671 (-) NCBI T2T-CHM13v2.0
Or1d2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 59,711,377 - 59,712,312 (+) NCBI GRCr8 mRatBN7.2 10 59,212,947 - 59,213,882 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 59,207,257 - 59,214,085 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 63,858,981 - 63,859,916 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 63,364,592 - 63,365,527 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 58,827,074 - 58,828,009 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 61,160,125 - 61,161,060 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 61,152,379 - 61,153,198 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 61,160,125 - 61,161,060 (+) Ensembl Rnor6.0 rn6 Rnor6.0 RGSC_v3.4 10 61,632,798 - 61,633,733 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 61,646,420 - 61,647,356 (+) NCBI Celera 10 58,245,853 - 58,246,788 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
LOC100992356 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 10,657,516 - 10,678,468 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 12,624,688 - 12,644,835 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 3,081,014 - 3,087,934 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 3,083,513 - 3,084,466 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 3,083,513 - 3,084,451 (-) Ensembl panpan1.1 panPan2
OR1D10P (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 47,061,492 - 47,062,546 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 47,061,492 - 47,062,498 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 46,213,588 - 46,214,594 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 47,896,453 - 47,897,459 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 47,896,453 - 47,897,459 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 46,660,812 - 46,661,818 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 46,957,061 - 46,958,067 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 47,009,991 - 47,010,997 (-) NCBI UU_Cfam_GSD_1.0
LOC103242147 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 2,754,981 - 2,766,197 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 2,765,210 - 2,766,148 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 19,135,063 - 19,136,087 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 89 Count of miRNA genes: 85 Interacting mature miRNAs: 89 Transcripts: ENSMUST00000077794 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226783 Tibl5_m tibia length 5, 5 week (mouse) 11 68190826 101890826 Mouse 1300628 Lgth6_m body length 6 (mouse) Not determined 11 66733420 100733652 Mouse 4141367 Inf1_m acute ozone induced inflammation (mouse) Not determined 44630038 113058009 Mouse 1558812 Rafar_m retinoic acid induced forelimb autopod reduction (mouse) Not determined 11 70691198 104691366 Mouse 1300765 Bbaa4_m B.burgdorferi-associated arthritis 4 (mouse) Not determined 11 46185167 80185262 Mouse 1301404 Sbmd4_m spinal bone mineral density 4 (mouse) Not determined 11 72019649 106019734 Mouse 1302021 Nidd1n_m non-insulin-dependent diabetes mellitus 1 in NSY (mouse) Not determined 11 45165873 79978324 Mouse 4142121 Tmc1m2_m Tmc1 modifier 2 (mouse) Not determined 11 56864027 114157957 Mouse 4141982 Skts-fp2_m skin tumor susceptibility in FVB and PWK 2 (mouse) Not determined 58719266 85066529 Mouse 1357878 Mastr_m modifier of astrocytoma (mouse) Not determined 11 45708581 89818733 Mouse 1301681 Sle13_m systematic lupus erythematosus susceptibility 13 (mouse) Not determined 11 70691198 104691366 Mouse 1300784 Prdt3_m prion disease incubation time 3 (mouse) Not determined 11 66733420 100733652 Mouse 4141339 Nilac2_m nicotine induced locomotor activity 2 (mouse) Not determined 11 70691198 104691366 Mouse 11039501 Ltpr6a_m Leishmania tropica response 6a (mouse) 11 64830336 98830473 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 13524840 Ppiq9a_m prepulse inhibition QTL 9a (mouse) 11 52494385 86494385 Mouse 11039502 Ltpr6b_m Leishmania tropica response 6b (mouse) 11 64830336 98830473 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 1300664 Etohcta9_m ethanol conditioned taste aversion 9 (mouse) Not determined 11 57754660 91754758 Mouse 10053682 Eae45_m experimental allergic encephalomyelitis susceptibility 45 (mouse) Not determined 11 58490555 74754758 Mouse 1301310 Tmevd5_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse) Not determined 11 72726125 106726289 Mouse 1300924 Ity2_m immunity to S. typhimurium 2 (mouse) Not determined 1 58508030 87695238 Mouse 13208569 Bmiq10_m body mass index QTL 10 (mouse) 11 35890827 84890826 Mouse 11039515 Ltpr6_m Leishmania tropica response 6 (mouse) 11 64830336 98830473 Mouse 4142348 Pstc2_m periosteal circumference 2 (mouse) Not determined 11 72818615 106818733 Mouse 11532699 Sluc36b_m susceptibility to lung cancer 36b (mouse) 11 42256617 76256730 Mouse 11532698 Sluc36a_m susceptibility to lung cancer 36a (mouse) 11 42256617 76256730 Mouse 1300774 Pgia7_m proteoglycan induced arthritis 7 (mouse) Not determined 11 53390588 87390737 Mouse 1300651 Pcyts3_m plasmacytoma susceptibility 3 (mouse) Not determined 11 70691198 104691366 Mouse 4141830 Pregq1_m pregnancy QTL 1 (mouse) Not determined 11 54126752 83733652 Mouse 1301546 Pcir2_m periosteal circumference 2 (mouse) Not determined 11 66733420 100733652 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 1301328 Mol4_m modifier of LPS-response 4 (mouse) Not determined 11 36282577 83481356 Mouse 10043866 Adip19_m adiposity 19 (mouse) Not determined 11 72818615 106818733 Mouse 1301078 Alcp2_m alcohol preference locus 2 (mouse) Not determined 11 72209796 84731462 Mouse 10412246 Dfs2_m dental fluorosis suseptibility 2 (mouse) Not determined 11 21807364 95881231 Mouse 1357766 Si5lq6_m serum IGFBP-5 level QTL 6 (mouse) Not determined 11 66733420 100733652 Mouse 4142316 Ity2b_m immunity to S. typhimurium 2b (mouse) Not determined 11 67078191 79813912 Mouse 1301319 Dautb4_m dopamine uptake transporter binding 4 (mouse) Not determined 11 62156005 96156153 Mouse 1301830 Ssta4_m susceptibility to Salmonella typhimurium antigens 4 (mouse) Not determined 11 50078191 84078411 Mouse 1301833 Tbbmd5_m total body bone mineral density 5 (mouse) Not determined 11 66733420 100733652 Mouse 4142300 Ctrq3_m C. trachomatis resistance QTL 3 (mouse) Not determined 11 44630038 76854757 Mouse 4141012 Femwf6_m femur work to failure 6 (mouse) Not determined 66733420 100733652 Mouse 1301987 Pid3_m prior incubation determinant 3 (mouse) Not determined 11 61686820 88699728 Mouse 27226730 Tibmd1_m tibia midshaft diameter 1, 5 week (mouse) 11 62590826 109390826 Mouse 1301988 Bmd11_m bone mineral density 11 (mouse) Not determined 11 46319407 80319522 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 1301999 Lmr15_m leishmaniasis resistance 15 (mouse) Not determined 11 63319407 81830473 Mouse 10044004 Stzid3_m streptozotocin induced diabetes susceptibility 3 (mouse) Not determined 11 63319407 94063918 Mouse 12903994 Opfaq3_m open field activity QTL 3 (mouse) 11 73737541 82069425 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000077794 ⟹ ENSMUSP00000076967
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 74,255,497 - 74,256,435 (+) Ensembl GRCm38.p6 Ensembl 11 74,364,671 - 74,365,609 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000216362 ⟹ ENSMUSP00000149922
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 74,252,895 - 74,257,044 (+) Ensembl GRCm38.p6 Ensembl 11 74,362,069 - 74,366,218 (+) Ensembl
RefSeq Acc Id:
NM_001011851 ⟹ NP_001011851
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 74,255,497 - 74,256,435 (+) NCBI GRCm38 11 74,364,671 - 74,365,609 (+) ENTREZGENE MGSCv37 11 74,178,173 - 74,179,111 (+) RGD Celera 11 81,877,216 - 81,878,154 (+) RGD cM Map 11 ENTREZGENE
Sequence:
ATGGACGGAGGCAACCAGAGTGGGGACTCTGAGTTCCTCCTCCTGGGACTCTCGGAGGTTCCTGAGCATCAGCGCATCCTATTCTGGACCTTCCTGTCCATGTACCTGGTCACAGTGGTGGGGAACGT GCTCATCATCCTGGCCATTGGCTCTGACTCGCACCTGCACACTCCCATGTATTTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACTATCCCCAAGATGCTGGTGAGCCTTC AATCCCAGAACAAAGCTATCTCCTATCCAGGATGTCTGACACAGCTCTTCTTCCTGGTGTCTTTGGTAGCCTTGGACAATCTCATCCTGGCTGTAATGGCATATGACCGTTATGTGGCCATCTGTCAC CCCCTCCATTACACTACAGCCATGAGTCCCAAGCTCTGTATCTTACTTCTCATCTTGTGCTGGGCCCTATCTATCCTTTATGGCCTCATCCACACCCTCCTCATGACCAGAGTAACCTTCTGTGGGTC TCGGAAAATCCACTACATCTTCTGCGAAATGTATGTCCTGCTGAGGCTTGCATGCTCTAACACCCACATCAATCACATGATGCTGATCGCCACGGGCTGCTTCGTCTTCCTTGTTCCTTTTGGATTCA TGATCATGTCCTATATCTGCATTGTCAGAGCTATCCTCAAAATTCCTTCAGCCTCTAACAAGTACAAAGCCTTTTCCACCTGTGCGTCCCATCTGGCTGTGGTGGCCCTCTTCTATGGGACACTGTGT ATGGTGTATCTGAAACCCCTGCACACCTACTCCATGAAAGACTCAGTAGCCACTGTGATGTATGCAGTGGTGACACCCATGATGAACCCTTTCATCTACAGCCTGAGGAACAAGGACATGCACGGGGC TCTGGGAAGACTGCTAAGGAAGCCACTTCAGAAGCTAACATGA
hide sequence
RefSeq Acc Id:
NP_001011851 ⟸ NM_001011851
- UniProtKB:
Q7TRW7 (UniProtKB/TrEMBL)
- Sequence:
MDGGNQSGDSEFLLLGLSEVPEHQRILFWTFLSMYLVTVVGNVLIILAIGSDSHLHTPMYFFLANLSFTDLFFVTNTIPKMLVSLQSQNKAISYPGCLTQLFFLVSLVALDNLILAVMAYDRYVAICH PLHYTTAMSPKLCILLLILCWALSILYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRLACSNTHINHMMLIATGCFVFLVPFGFMIMSYICIVRAILKIPSASNKYKAFSTCASHLAVVALFYGTLC MVYLKPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLRKPLQKLT
hide sequence
Ensembl Acc Id:
ENSMUSP00000149922 ⟸ ENSMUST00000216362
Ensembl Acc Id:
ENSMUSP00000076967 ⟸ ENSMUST00000077794
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-05-24
Or1d2
olfactory receptor family 1 subfamily D member 2
Olfr412
olfactory receptor 412
Symbol and/or name change
5135510
APPROVED