Symbol:
Pcgf3
Name:
polycomb group ring finger 3
RGD ID:
1551802
MGI Page
MGI
Description:
Enables histone H2AK119 ubiquitin ligase activity. Involved in random inactivation of X chromosome. Part of PcG protein complex. Colocalizes with X chromosome. Is expressed in several structures, including branchial arch; central nervous system; limb; otocyst; and urinary system. Orthologous to human PCGF3 (polycomb group ring finger 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2310035N15Rik; AI662857; D630042K08Rik; DON; DONG1; E430039C14; polycomb group RING finger protein 3; ring finger protein 3; RING finger protein 3A; RN; Rnf3; RNF3A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PCGF3 (polycomb group ring finger 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Pcgf3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pcgf3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PCGF3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PCGF3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pcgf3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PCGF3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PCGF3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pcgf3 (polycomb group ring finger 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Pcgf3 (polycomb group ring finger 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PCGF3 (polycomb group ring finger 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mig-32
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
l(3)73Ah
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pcgf3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 108,609,082 - 108,654,842 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 108,609,098 - 108,654,842 (+) Ensembl GRCm39 Ensembl GRCm38 5 108,461,259 - 108,506,976 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 108,461,232 - 108,506,976 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 108,890,351 - 108,932,118 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 108,701,634 - 108,743,401 (+) NCBI MGSCv36 mm8 Celera 5 105,582,876 - 105,624,630 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 53.13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pcgf3 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PCGF3 mRNA CTD PMID:36331819 Pcgf3 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PCGF3 mRNA CTD PMID:22206623 Pcgf3 Mouse 17alpha-ethynylestradiol increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of PCGF3 mRNA CTD PMID:29097150 Pcgf3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PCGF3 mRNA CTD PMID:21570461 Pcgf3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCGF3 mRNA CTD PMID:33387578 Pcgf3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PCGF3 mRNA CTD PMID:32109520 Pcgf3 Mouse 6-propyl-2-thiouracil decreases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PCGF3 mRNA CTD PMID:25825206 Pcgf3 Mouse 6-propyl-2-thiouracil increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of PCGF3 mRNA CTD PMID:30047161 Pcgf3 Mouse aflatoxin B1 decreases methylation ISO PCGF3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PCGF3 gene CTD PMID:27153756 Pcgf3 Mouse aflatoxin B1 increases methylation ISO PCGF3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PCGF3 intron CTD PMID:30157460 Pcgf3 Mouse amitrole increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Amitrole results in increased expression of PCGF3 mRNA CTD PMID:30047161 Pcgf3 Mouse antirheumatic drug decreases expression ISO PCGF3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PCGF3 mRNA CTD PMID:24449571 Pcgf3 Mouse arsane affects methylation ISO PCGF3 (Homo sapiens) 6480464 Arsenic affects the methylation of PCGF3 gene CTD PMID:25304211 Pcgf3 Mouse arsenic atom affects methylation ISO PCGF3 (Homo sapiens) 6480464 Arsenic affects the methylation of PCGF3 gene CTD PMID:25304211 Pcgf3 Mouse arsenite(3-) multiple interactions ISO PCGF3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PCGF3 mRNA] CTD PMID:32406909 Pcgf3 Mouse atrazine increases expression ISO PCGF3 (Homo sapiens) 6480464 Atrazine results in increased expression of PCGF3 mRNA CTD PMID:22378314 Pcgf3 Mouse benzo[a]pyrene affects methylation ISO PCGF3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PCGF3 5' UTR and Benzo(a)pyrene affects the methylation of PCGF3 intron CTD PMID:27901495 and PMID:30157460 Pcgf3 Mouse benzo[e]pyrene increases methylation ISO PCGF3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PCGF3 intron CTD PMID:30157460 Pcgf3 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PCGF3 mRNA CTD PMID:26063408 Pcgf3 Mouse bisphenol A decreases methylation ISO PCGF3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PCGF3 gene CTD PMID:31601247 Pcgf3 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PCGF3 mRNA CTD PMID:33221593 Pcgf3 Mouse bisphenol A increases methylation ISO Pcgf3 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of PCGF3 gene CTD PMID:28505145 Pcgf3 Mouse bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PCGF3 promoter CTD PMID:27312807 Pcgf3 Mouse bisphenol A increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PCGF3 mRNA CTD PMID:25181051 and PMID:29097150 Pcgf3 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PCGF3 mRNA CTD PMID:38685157 Pcgf3 Mouse bortezomib increases expression ISO PCGF3 (Homo sapiens) 6480464 Bortezomib results in increased expression of PCGF3 mRNA CTD PMID:20977926 Pcgf3 Mouse butanal decreases expression ISO PCGF3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PCGF3 mRNA CTD PMID:26079696 Pcgf3 Mouse cadmium dichloride decreases expression ISO PCGF3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PCGF3 mRNA CTD PMID:38382870 Pcgf3 Mouse Dibutyl phosphate affects expression ISO PCGF3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PCGF3 mRNA CTD PMID:37042841 Pcgf3 Mouse dibutyl phthalate increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of PCGF3 mRNA CTD PMID:21266533 Pcgf3 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of PCGF3 mRNA CTD PMID:30319688 Pcgf3 Mouse folic acid increases expression ISO PCGF3 (Homo sapiens) 6480464 Folic Acid results in increased expression of PCGF3 mRNA CTD PMID:21867686 Pcgf3 Mouse fulvestrant increases methylation ISO PCGF3 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of PCGF3 gene CTD PMID:31601247 Pcgf3 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PCGF3 mRNA CTD PMID:36331819 Pcgf3 Mouse methapyrilene decreases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of PCGF3 mRNA CTD PMID:30467583 Pcgf3 Mouse methapyrilene increases methylation ISO PCGF3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PCGF3 intron CTD PMID:30157460 Pcgf3 Mouse methimazole increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Methimazole results in increased expression of PCGF3 mRNA CTD PMID:30047161 Pcgf3 Mouse mitomycin C increases expression EXP 6480464 Mitomycin results in increased expression of PCGF3 mRNA CTD PMID:25270620 Pcgf3 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Pcgf3 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PCGF3 gene CTD PMID:33148267 Pcgf3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PCGF3 mRNA CTD PMID:17562736 Pcgf3 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PCGF3 mRNA more ... CTD PMID:36331819 Pcgf3 Mouse permethrin multiple interactions ISO Pcgf3 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of PCGF3 gene CTD PMID:33148267 Pcgf3 Mouse sulfadimethoxine increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of PCGF3 mRNA CTD PMID:30047161 Pcgf3 Mouse sunitinib decreases expression ISO PCGF3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PCGF3 mRNA CTD PMID:31533062 Pcgf3 Mouse thioacetamide increases expression ISO Pcgf3 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of PCGF3 mRNA CTD PMID:23411599 and PMID:34492290 Pcgf3 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PCGF3 promoter CTD PMID:35295148 Pcgf3 Mouse trichostatin A decreases expression ISO PCGF3 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PCGF3 mRNA CTD PMID:26272509 Pcgf3 Mouse valproic acid increases methylation ISO PCGF3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PCGF3 gene CTD PMID:29154799 Pcgf3 Mouse valproic acid decreases expression ISO PCGF3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PCGF3 mRNA CTD PMID:26272509
1.
PRC1 complex diversity: where is it taking us?
Gil J and O'Loghlen A, Trends Cell Biol. 2014 Jul 22. pii: S0962-8924(14)00102-0. doi: 10.1016/j.tcb.2014.06.005.
2.
Mouse brain organization revealed through direct genome-scale TF expression analysis.
Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Occupying chromatin: Polycomb mechanisms for getting to genomic targets, stopping transcriptional traffic, and staying put.
Simon JA and Kingston RE, Mol Cell. 2013 Mar 7;49(5):808-24. doi: 10.1016/j.molcel.2013.02.013.
Pcgf3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 108,609,082 - 108,654,842 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 108,609,098 - 108,654,842 (+) Ensembl GRCm39 Ensembl GRCm38 5 108,461,259 - 108,506,976 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 108,461,232 - 108,506,976 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 108,890,351 - 108,932,118 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 108,701,634 - 108,743,401 (+) NCBI MGSCv36 mm8 Celera 5 105,582,876 - 105,624,630 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 53.13 NCBI
PCGF3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 705,832 - 770,089 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 705,748 - 770,089 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 699,621 - 763,877 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 689,573 - 754,428 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 689,572 - 754,255 NCBI Celera 4 654,586 - 701,073 (+) NCBI Celera Cytogenetic Map 4 p16.3 NCBI HuRef 4 674,466 - 735,220 (+) NCBI HuRef CHM1_1 4 699,353 - 761,389 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 705,458 - 767,880 (+) NCBI T2T-CHM13v2.0
Pcgf3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 1,381,976 - 1,436,709 (-) NCBI GRCr8 mRatBN7.2 14 1,237,594 - 1,291,717 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 1,233,947 - 1,291,793 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 1,136,329 - 1,173,467 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 2,438,091 - 2,475,222 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 1,134,803 - 1,171,901 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 2,247,805 - 2,297,155 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 2,247,808 - 2,297,155 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 2,242,206 - 2,295,509 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 1,824,819 - 1,839,263 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 1,784,275 - 1,835,105 (-) NCBI Celera 14 1,276,942 - 1,313,583 (-) NCBI Celera Cytogenetic Map 14 p22 NCBI
Pcgf3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955514 307,332 - 350,039 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955514 307,331 - 350,039 (+) NCBI ChiLan1.0 ChiLan1.0
PCGF3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 1,015,288 - 1,086,487 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 973,254 - 1,043,017 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 802,990 - 874,063 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 746,147 - 805,443 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 746,137 - 805,443 (+) Ensembl panpan1.1 panPan2
PCGF3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 91,673,424 - 91,708,751 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 91,676,496 - 91,708,754 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 94,138,937 - 94,187,941 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 92,673,047 - 92,722,052 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 92,673,047 - 92,722,019 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 91,844,192 - 91,893,180 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 91,900,171 - 91,949,129 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 92,281,790 - 92,330,796 (-) NCBI UU_Cfam_GSD_1.0
Pcgf3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 68,647,474 - 68,671,564 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936477 22,349,171 - 22,373,393 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936477 22,349,166 - 22,373,256 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PCGF3
PCGF3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 48,015,976 - 48,077,688 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 48,020,010 - 48,053,520 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 4,401,028 - 4,463,055 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pcgf3
.
Predicted Target Of
Count of predictions: 3160 Count of miRNA genes: 945 Interacting mature miRNAs: 1344 Transcripts: ENSMUST00000046975, ENSMUST00000112597, ENSMUST00000138264, ENSMUST00000143973, ENSMUST00000151897 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10045978 Tir10_m trypanosome infection response 10 (mouse) Not determined 5 98019649 114021986 Mouse 1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 25314310 Syncl4_m synaptonemal complex length 4 (mouse) 5 103047866 115538059 Mouse 1301524 Lmb2_m lupus in MRL and B6 F2 cross (mouse) Not determined 5 37581488 112465722 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 1357725 Eae39_m experimental allergic encephalomyelitis 39 (mouse) Not determined 5 89418876 118864028 Mouse 14746986 Manh58_m mandible shape 58 (mouse) 5 102446283 136446283 Mouse 25314317 Sccor3_m synaptonemal complex length to mean MLH1 count ratio 3 (mouse) 5 104347866 114738061 Mouse 1300993 Hycdc_m hypercapnic duty cycle (mouse) Not determined 5 90561006 124561151 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 1300659 Pcd8ts1_m p-glycoprotein positive CD8 T cell subset 1 (mouse) Not determined 5 97021753 131021986 Mouse 1301042 Elmaz1_m elevated maze behavior 1 (mouse) Not determined 5 98019649 116876624 Mouse 1301691 Cdcs10_m cytokine deficiency colitis susceptibility 10 (mouse) Not determined 5 76280786 110280917 Mouse 10402486 Dipa1_m drug induced psychomotor activation 1 (mouse) Not determined 5 95465549 129465722 Mouse 1357886 Diht_m dopamine-induced hypothermia (mouse) Not determined 5 104498738 115101540 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 10412202 Bbaa26_m B.burgdorferi-associated arthritis 26 (mouse) Not determined 5 104583688 138555455 Mouse 12904945 Tammq2_m tibialis anterior muscle mass QTL 2 (mouse) 5 100665965 134665965 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 12904959 Smmq1_m soleus muscle mass QTL 1 (mouse) 5 100665965 134665965 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 10401246 Bglu13_m blood glucose level 13 (mouse) Not determined 5 79539640 113539786 Mouse 4141438 Skmw13_m skeletal muscle weight 13 (mouse) Not determined 5 76190263 110190479 Mouse 1301713 Dbsty2_m diabesity 2 (mouse) Not determined 5 76445064 110445225 Mouse 1301457 Cfsw2_m cystic fibrosis survival to weaning 2 (mouse) Not determined 5 90561006 124561151 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 1301974 Chab7_m cholesterol absorption 7 (mouse) Not determined 5 95233214 129233330 Mouse 11528550 Sluc33_m susceptibility to lung cancer 33 (mouse) 5 104386871 120711986 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 1300931 Cocrb6_m cocaine related behavior 6 (mouse) Not determined 5 76445064 110445225 Mouse 10412239 Alpq7_m alcohol preference QTL 7 (mouse) Not determined 5 104705939 138705939 Mouse 4142317 Rgcs1_m retinal ganglion cell susceptible 1 (mouse) Not determined 55388334 108762627 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 1301829 Thyls2_m thymic lymphoma susceptibility 2 (mouse) Not determined 5 76445064 110445225 Mouse 9587780 Afw16_m abdominal fat weight QTL 16 (mouse) Not determined 5 92830166 126830285 Mouse 1357644 Egrd1_m early growth rate, direct effect 1 (mouse) Not determined 5 95434580 129434786 Mouse 1357901 Mdmsc2_m modifier of muscularity 2 (mouse) Not determined 5 107561006 112434786 Mouse 12859290 Criq2_m Citrobacter rodentium infection QTL 2 (mouse) 5 101332579 135332579 Mouse 1300940 Actd3_m activity-distance traveled 3 (mouse) Not determined 5 96320385 130320533 Mouse 10755524 Mono1_m monocyte differential 1 (mouse) 5 80849259 114849259 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 1558774 Lith17_m lithogenic gene 17 (mouse) Not determined 5 95465549 129465722 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 1301877 Bbaa3_m B.burgdorferi-associated arthritis 3 (mouse) Not determined 5 99455285 112465722 Mouse 1300986 Hdlq2_m HDL QTL 2 (mouse) Not determined 5 76280786 110280917 Mouse 1301624 Aevm2_m autoimmune extremity vasculitis in MRL mice 2 (mouse) Not determined 5 101863832 135864028 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 11532736 Sluc33b_m susceptibility to lung cancer 33b (mouse) 5 102945037 136945196 Mouse 4141519 Hmtb5_m hemostasis and thrombosis bleeding time 5 (mouse) Not determined 99949422 126882944 Mouse 1301858 Smdq1_m segregation of mitochondrial DNA QTL 1 (mouse) Not determined 5 97021753 131021986 Mouse 11049562 Lmr24f_m leishmaniasis resistance 24f (mouse) 5 90320962 124321041 Mouse 13464249 Ahl16_m age related hearing loss, early onset 16 (mouse) 5 76445064 110445225 Mouse 13464244 Ahl19_m age related hearing loss, early onset 19 (mouse) 5 95465549 129465722 Mouse 1300968 Skts4_m skin tumor susceptibility 4 (mouse) Not determined 5 89418876 124238239 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 4141505 Chlq14_m circulating hormone level QTL 14 (mouse) Not determined 5 76280786 110280917 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
AI662857
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 108,504,111 - 108,504,229 UniSTS GRCm38 MGSCv37 5 108,933,130 - 108,933,248 UniSTS GRCm37 Celera 5 105,625,640 - 105,625,758 UniSTS Cytogenetic Map 5 F UniSTS Whitehead/MRC_RH 5 1331.38 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000046975 ⟹ ENSMUSP00000041790
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 108,609,098 - 108,654,842 (+) Ensembl GRCm38.p6 Ensembl 5 108,461,232 - 108,506,976 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112597 ⟹ ENSMUSP00000108216
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 108,609,098 - 108,637,090 (+) Ensembl GRCm38.p6 Ensembl 5 108,461,232 - 108,489,224 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138264 ⟹ ENSMUSP00000142465
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 108,609,179 - 108,634,037 (+) Ensembl GRCm38.p6 Ensembl 5 108,461,313 - 108,486,171 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143973
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 108,621,753 - 108,626,376 (+) Ensembl GRCm38.p6 Ensembl 5 108,473,887 - 108,478,510 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151897
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 108,634,086 - 108,644,156 (+) Ensembl GRCm38.p6 Ensembl 5 108,486,220 - 108,496,290 (+) Ensembl
RefSeq Acc Id:
NM_001377000 ⟹ NP_001363929
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,125 - 108,654,842 (+) NCBI GRCm38 5 108,461,259 - 108,506,976 (+) NCBI
Sequence:
ACACACTGCGCATGCTCCAGCCGCGGCGCCCCCGACTCCGCACTCGGCTGGGTTCGGGCATTTCCGCCTCTTTGTTTTAAACTCTGCACGGCTTTTTTCTCCTCCTCTTGGGGGGGACCCAGAGGGAG
hide sequence
RefSeq Acc Id:
NM_001377001 ⟹ NP_001363930
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,125 - 108,654,842 (+) NCBI GRCm38 5 108,461,259 - 108,506,976 (+) NCBI
Sequence:
ACACACTGCGCATGCTCCAGCCGCGGCGCCCCCGACTCCGCACTCGGCTGGGTTCGGGCATTTC
hide sequence
RefSeq Acc Id:
NM_172716 ⟹ NP_766304
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,125 - 108,654,842 (+) NCBI GRCm38 5 108,461,259 - 108,506,976 (+) NCBI MGSCv37 5 108,890,351 - 108,932,118 (+) RGD Celera 5 105,582,876 - 105,624,630 (+) RGD cM Map 5 ENTREZGENE
Sequence:
ACACACTGCGCATGCTCCAGCCGCGGCGCCCCCGACTCCGCACTCGGCTGGGTTCGGGCATTTC
hide sequence
RefSeq Acc Id:
XM_030254794 ⟹ XP_030110654
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,317 - 108,652,720 (+) NCBI GRCm38 5 108,461,503 - 108,504,473 (+) NCBI
Sequence:
GGTCAGTGAGCCCGCCCCGCCTGGCCTGGCCCGCGCGCCCGCTCCTCAGGCCGCGGGCCTCGGCCCATGGGCGGCAGAAGGCTGCGAGCCCAGCGCCCCCGGCAGGCCCGGGAGGCGGGACCCTAAAA
hide sequence
RefSeq Acc Id:
XM_036165475 ⟹ XP_036021368
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,082 - 108,648,310 (+) NCBI
Sequence:
TCAGAGGCCCCGCCTCTCTCGTTTGCGAGGTGGGAGCTGAGCCACACACTGCGCATGCTCCAGCCGCGGCGCCCCCGACTCCGCACTCGGCTGGGTTCGGGCATTTCCGCCTCTTTGTTTTAAACTCT
hide sequence
RefSeq Acc Id:
XM_036165476 ⟹ XP_036021369
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,317 - 108,648,310 (+) NCBI
Sequence:
GGTCAGTGAGCCCGCCCCGCCTGGCCTGGCCCGCGCGCCCGCTCCTCAGGCCGCGGGCCTCGGC
hide sequence
RefSeq Acc Id:
XM_036165477 ⟹ XP_036021370
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 108,609,082 - 108,645,769 (+) NCBI
Sequence:
TCAGAGGCCCCGCCTCTCTCGTTTGCGAGGTGGGAGCTGAGCCACACACTGCGCATGCTCCAGCCGCGGCGCCCCCGACTCCGCACTCGGCTGGGTTCGGGCATTTCCGCCTCTTTGTTTTAAACTCT
hide sequence
RefSeq Acc Id:
NP_766304 ⟸ NM_172716
- Peptide Label:
isoform 1
- UniProtKB:
Q8BZT0 (UniProtKB/Swiss-Prot), Q8BTQ0 (UniProtKB/Swiss-Prot)
- Sequence:
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLDPRNGETKA
hide sequence
RefSeq Acc Id:
XP_030110654 ⟸ XM_030254794
- Peptide Label:
isoform X2
- UniProtKB:
Q8BTQ0 (UniProtKB/Swiss-Prot), Q8BZT0 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001363930 ⟸ NM_001377001
- Peptide Label:
isoform 1
- UniProtKB:
Q8BTQ0 (UniProtKB/Swiss-Prot), Q8BZT0 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001363929 ⟸ NM_001377000
- Peptide Label:
isoform 2
Ensembl Acc Id:
ENSMUSP00000041790 ⟸ ENSMUST00000046975
Ensembl Acc Id:
ENSMUSP00000142465 ⟸ ENSMUST00000138264
Ensembl Acc Id:
ENSMUSP00000108216 ⟸ ENSMUST00000112597
RefSeq Acc Id:
XP_036021368 ⟸ XM_036165475
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_036021370 ⟸ XM_036165477
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_036021369 ⟸ XM_036165476
- Peptide Label:
isoform X1
RGD ID: 6887470 Promoter ID: EPDNEW_M7186 Type: initiation region Name: Pcgf3_1 Description: Mus musculus polycomb group ring finger 3 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 108,461,277 - 108,461,337 EPDNEW
RGD ID: 6838006 Promoter ID: MM_KWN:43286 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000112597, OTTMUST00000042247, OTTMUST00000042249 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 108,890,191 - 108,890,692 (+) MPROMDB
RGD ID: 6838007 Promoter ID: MM_KWN:43288 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour, Liver Transcripts: OTTMUST00000042251 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 108,914,319 - 108,914,819 (+) MPROMDB
