Symbol:
Ugt2a3
Name:
UDP glucuronosyltransferase 2 family, polypeptide A3
RGD ID:
1551260
MGI Page
MGI
Description:
Predicted to enable glucuronosyltransferase activity. Predicted to be located in membrane. Is expressed in nervous system; nose; and olfactory epithelium. Orthologous to human UGT2A3 (UDP glucuronosyltransferase family 2 member A3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2010321J07Rik; UDP-glucuronosyltransferase 2A3; UDPGT 2A3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UGT2A3 (UDP glucuronosyltransferase family 2 member A3)
HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ugt2a3 (UDP glucuronosyltransferase family 2 member A3)
RGD
RGD
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100978938 (UDP-glucuronosyltransferase 2A3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UGT2A3 (UDP glucuronosyltransferase family 2 member A3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100624788 (UDP-glucuronosyltransferase 2A1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
UGT2B10 (UDP glucuronosyltransferase family 2 member B10)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2B15 (UDP glucuronosyltransferase family 2 member B15)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2B4 (UDP glucuronosyltransferase family 2 member B4)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2B11 (UDP glucuronosyltransferase family 2 member B11)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2B17 (UDP glucuronosyltransferase family 2 member B17)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2B7 (UDP glucuronosyltransferase family 2 member B7)
HGNC
OrthoDB, OrthoMCL
Homo sapiens (human):
UGT2A1 (UDP glucuronosyltransferase family 2 member A1 complex locus)
HGNC
OrthoMCL
Homo sapiens (human):
UGT2B28 (UDP glucuronosyltransferase family 2 member B28)
HGNC
OrthoMCL
Homo sapiens (human):
UGT2A2 (UDP glucuronosyltransferase family 2 member A2)
HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ugt2a3 (UDP glucuronosyltransferase family 2 member A3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
UGT2A3 (UDP glucuronosyltransferase family 2 member A3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ugt2a4 (UDP glucuronosyltransferase 2 family, polypeptide A4)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ugt2b5 (UDP glucuronosyltransferase 2 family, polypeptide B5)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ugt2a2 (UDP glucuronosyltransferase 2 family, polypeptide A2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ugt2b3 (UDP glucuronosyltransferase 2 family, polypeptide B3)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ugt2a5 (UDP glucuronosyltransferase 2 family, polypeptide A5)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG10168
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|SonicParanoid)
Caenorhabditis elegans (roundworm):
F10D2.8
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-7
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
CG10170
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
ugt-44
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ugt-12
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ugt-13
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-15
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-16
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-17
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-18
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-20
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-22
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA)
Caenorhabditis elegans (roundworm):
ugt-23
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-24
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-27
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-29
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-30
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-8
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG11289
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG16732
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
ugt-19
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-35
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-41
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ugt-42
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ugt-6
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-62
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17322
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector)
Drosophila melanogaster (fruit fly):
CG17323
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder)
Drosophila melanogaster (fruit fly):
CG17324
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder)
Drosophila melanogaster (fruit fly):
CG18869
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Ugt35b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ugt86De
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ugt86Dg
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ugt86Dj
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4302
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6475
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dot
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Drosophila melanogaster (fruit fly):
Ugt86Dh
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
H23N18.4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Drosophila melanogaster (fruit fly):
CG5999
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Drosophila melanogaster (fruit fly):
Ugt37b1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Drosophila melanogaster (fruit fly):
CG3797
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
ugt-61
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ugt35a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ugt36Bc
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
ugt-33
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-34
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-39
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Caenorhabditis elegans (roundworm):
ugt-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|PANTHER)
Drosophila melanogaster (fruit fly):
Ugt86Dd
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ugt-31
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ugt2a1
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 87,472,694 - 87,485,054 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 87,472,831 - 87,485,054 (-) Ensembl GRCm39 Ensembl GRCm38 5 87,324,972 - 87,337,195 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 87,324,972 - 87,337,195 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 87,753,997 - 87,766,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 88,399,533 - 88,411,737 (-) NCBI MGSCv36 mm8 Celera 5 84,541,315 - 84,553,528 (-) NCBI Celera Cytogenetic Map 5 E1 NCBI cM Map 5 43.56 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ugt2a3 Mouse (+)-schisandrin B multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of UGT2A3 mRNA] CTD PMID:31150632 Ugt2a3 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of UGT2A3 mRNA CTD PMID:36331819 Ugt2a3 Mouse (2,4,5-trichlorophenoxy)acetic acid increases expression EXP 6480464 2 more ... CTD PMID:18579281 Ugt2a3 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of UGT2A3 mRNA CTD PMID:28189721 and PMID:28960355 Ugt2a3 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of UGT2A3 mRNA CTD PMID:39298647 Ugt2a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of UGT2A3 mRNA CTD PMID:19144771 more ... Ugt2a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of UGT2A3 mRNA CTD PMID:32109520 Ugt2a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of UGT2A3 mRNA CTD PMID:21724226 Ugt2a3 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of UGT2A3 mRNA] CTD PMID:22496397 Ugt2a3 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Ugt2a3 Mouse 3,3',4,4'-tetrachlorobiphenyl multiple interactions EXP 6480464 3 more ... CTD PMID:19467301 Ugt2a3 Mouse 3,4-dihydroxybenzoic acid multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 protocatechuic acid inhibits the reaction [bisphenol A results in increased expression of UGT2A3 mRNA] CTD PMID:37105472 Ugt2a3 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of UGT2A3 mRNA CTD PMID:39298647 Ugt2a3 Mouse acetamide decreases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 acetamide results in decreased expression of UGT2A3 mRNA CTD PMID:31881176 Ugt2a3 Mouse aflatoxin B1 decreases methylation ISO UGT2A3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of UGT2A3 gene CTD PMID:27153756 Ugt2a3 Mouse arotinoid acid multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Ugt2a3 Mouse arsane affects methylation ISO UGT2A3 (Homo sapiens) 6480464 Arsenic affects the methylation of UGT2A3 gene CTD PMID:25304211 Ugt2a3 Mouse arsenic atom affects methylation ISO UGT2A3 (Homo sapiens) 6480464 Arsenic affects the methylation of UGT2A3 gene CTD PMID:25304211 Ugt2a3 Mouse atrazine affects methylation ISO Ugt2a3 (Rattus norvegicus) 6480464 Atrazine affects the methylation of UGT2A3 gene CTD PMID:28931070 Ugt2a3 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of UGT2A3 mRNA CTD PMID:20127859 Ugt2a3 Mouse benzo[a]pyrene decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of UGT2A3 mRNA CTD PMID:21632981 more ... Ugt2a3 Mouse beta-naphthoflavone decreases expression EXP 6480464 beta-Naphthoflavone results in decreased expression of UGT2A3 mRNA CTD PMID:19144771 Ugt2a3 Mouse bisphenol A decreases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of UGT2A3 mRNA CTD PMID:25181051 Ugt2a3 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UGT2A3 mRNA CTD PMID:33221593 Ugt2a3 Mouse bisphenol A multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 cyanidin-3-O-beta-glucopyranoside inhibits the reaction [bisphenol A results in increased expression of UGT2A3 mRNA] and protocatechuic acid inhibits the reaction [bisphenol A results in increased expression of UGT2A3 mRNA] CTD PMID:37105472 Ugt2a3 Mouse bisphenol A increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of UGT2A3 mRNA CTD PMID:37105472 Ugt2a3 Mouse bisphenol A affects expression ISO UGT2A3 (Homo sapiens) 6480464 bisphenol A affects the expression of UGT2A3 mRNA CTD PMID:30903817 Ugt2a3 Mouse cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of UGT2A3 mRNA CTD PMID:31052254 Ugt2a3 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of UGT2A3 mRNA CTD PMID:25620056 Ugt2a3 Mouse CGP 52608 multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to UGT2A3 gene] CTD PMID:28238834 Ugt2a3 Mouse chenodeoxycholic acid decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Chenodeoxycholic Acid results in decreased expression of UGT2A3 mRNA CTD PMID:27174168 Ugt2a3 Mouse CHIR 99021 multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Ugt2a3 Mouse chlorohydrocarbon multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of UGT2A3 mRNA CTD PMID:30744511 Ugt2a3 Mouse cisplatin decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of UGT2A3 mRNA CTD PMID:27392435 Ugt2a3 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with PPARA protein mutant form] results in increased expression of UGT2A3 mRNA CTD PMID:22496397 Ugt2a3 Mouse copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of UGT2A3 mRNA CTD PMID:18579281 Ugt2a3 Mouse cortisol multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [4-(2-(5 more ... CTD PMID:34480604 Ugt2a3 Mouse cyclosporin A decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of UGT2A3 mRNA CTD PMID:20106945 more ... Ugt2a3 Mouse dexamethasone affects expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Dexamethasone affects the expression of UGT2A3 mRNA CTD PMID:15102944 Ugt2a3 Mouse Diallyl sulfide decreases expression EXP 6480464 allyl sulfide results in decreased expression of UGT2A3 mRNA CTD PMID:19144771 Ugt2a3 Mouse dicrotophos decreases expression ISO UGT2A3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of UGT2A3 mRNA CTD PMID:28302478 Ugt2a3 Mouse ethanol decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Ethanol results in decreased expression of UGT2A3 mRNA CTD PMID:31059573 Ugt2a3 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of UGT2A3 mRNA CTD PMID:34813904 Ugt2a3 Mouse fipronil increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 fipronil results in increased expression of UGT2A3 mRNA CTD PMID:23962444 Ugt2a3 Mouse indole-3-methanol multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of UGT2A3 mRNA CTD PMID:22129741 Ugt2a3 Mouse L-ascorbic acid multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of UGT2A3 mRNA CTD PMID:34480604 Ugt2a3 Mouse L-ascorbic acid 2-phosphate multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of UGT2A3 mRNA CTD PMID:34480604 Ugt2a3 Mouse metformin increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Metformin results in increased expression of UGT2A3 mRNA CTD PMID:31324951 Ugt2a3 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of UGT2A3 mRNA CTD PMID:34813904 Ugt2a3 Mouse methyl methanesulfonate decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of UGT2A3 mRNA CTD PMID:23649840 Ugt2a3 Mouse methylmercury chloride multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of UGT2A3 mRNA CTD PMID:30744511 Ugt2a3 Mouse N-nitrosodiethylamine multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of UGT2A3 mRNA CTD PMID:22129741 Ugt2a3 Mouse okadaic acid decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of UGT2A3 mRNA CTD PMID:38832940 Ugt2a3 Mouse oltipraz decreases expression EXP 6480464 oltipraz results in decreased expression of UGT2A3 mRNA CTD PMID:22496397 Ugt2a3 Mouse orphenadrine affects expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Orphenadrine affects the expression of UGT2A3 mRNA CTD PMID:23665939 Ugt2a3 Mouse oxybenzone decreases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 oxybenzone results in decreased expression of UGT2A3 mRNA CTD PMID:30316929 Ugt2a3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of UGT2A3 mRNA CTD PMID:17562736 Ugt2a3 Mouse paracetamol decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of UGT2A3 mRNA CTD PMID:29067470 Ugt2a3 Mouse paracetamol multiple interactions EXP 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in decreased expression of UGT2A3 mRNA] CTD PMID:29246445 Ugt2a3 Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of UGT2A3 mRNA CTD PMID:29246445 Ugt2a3 Mouse perfluorononanoic acid decreases expression ISO UGT2A3 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of UGT2A3 mRNA CTD PMID:32588087 Ugt2a3 Mouse perfluorooctane-1-sulfonic acid affects expression EXP 6480464 perfluorooctane sulfonic acid affects the expression of UGT2A3 mRNA CTD PMID:19429403 Ugt2a3 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of UGT2A3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of UGT2A3 mRNA CTD PMID:36331819 Ugt2a3 Mouse perfluorooctanoic acid affects expression EXP 6480464 perfluorooctanoic acid affects the expression of UGT2A3 mRNA CTD PMID:18281256 and PMID:19429403 Ugt2a3 Mouse phenformin increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Phenformin results in increased expression of UGT2A3 mRNA CTD PMID:31324951 Ugt2a3 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of UGT2A3 mRNA CTD PMID:19136022 Ugt2a3 Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of UGT2A3 mRNA CTD PMID:19136022 Ugt2a3 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of UGT2A3 mRNA CTD PMID:23811191 Ugt2a3 Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of UGT2A3 mRNA CTD PMID:19144771 more ... Ugt2a3 Mouse quercetin decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Quercetin results in decreased expression of UGT2A3 mRNA CTD PMID:21632981 Ugt2a3 Mouse rotenone increases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Rotenone results in increased expression of UGT2A3 mRNA CTD PMID:28374803 Ugt2a3 Mouse SB 431542 multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in increased expression of UGT2A3 mRNA CTD PMID:34480604 Ugt2a3 Mouse senecionine decreases expression ISO UGT2A3 (Homo sapiens) 6480464 senecionine results in decreased expression of UGT2A3 mRNA CTD PMID:26100227 Ugt2a3 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of UGT2A3 mRNA CTD PMID:33933676 Ugt2a3 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of UGT2A3 mRNA CTD PMID:27339419 and PMID:31919559 Ugt2a3 Mouse tetrachloromethane decreases expression ISO Ugt2a3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of UGT2A3 mRNA CTD PMID:31150632 Ugt2a3 Mouse tetrachloromethane multiple interactions ISO Ugt2a3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of UGT2A3 mRNA] CTD PMID:31150632 Ugt2a3 Mouse tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of UGT2A3 mRNA CTD PMID:16917069 Ugt2a3 Mouse trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of UGT2A3 mRNA CTD PMID:29353386 Ugt2a3 Mouse valproic acid decreases expression ISO UGT2A3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of UGT2A3 mRNA CTD PMID:29154799 Ugt2a3 Mouse valproic acid decreases methylation ISO UGT2A3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of UGT2A3 gene CTD PMID:29154799 Ugt2a3 Mouse vinclozolin increases methylation ISO Ugt2a3 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of UGT2A3 gene CTD PMID:31682807 Ugt2a3 Mouse XAV939 multiple interactions ISO UGT2A3 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of UGT2A3 mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of UGT2A3 mRNA CTD PMID:34480604
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (EXP) (2,4,5-trichlorophenoxy)acetic acid (EXP) 1,2-dichloroethane (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 3,3',4,4'-tetrachlorobiphenyl (EXP) 3,4-dihydroxybenzoic acid (ISO) 4,4'-sulfonyldiphenol (EXP) acetamide (ISO) aflatoxin B1 (ISO) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) cannabidiol (EXP) carbon nanotube (EXP) CGP 52608 (ISO) chenodeoxycholic acid (ISO) CHIR 99021 (ISO) chlorohydrocarbon (ISO) cisplatin (ISO) clofibrate (EXP) copper(II) sulfate (EXP) cortisol (ISO) cyclosporin A (ISO) dexamethasone (ISO) Diallyl sulfide (EXP) dicrotophos (ISO) ethanol (ISO) fenthion (EXP) fipronil (ISO) indole-3-methanol (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) metformin (ISO) methidathion (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (ISO) okadaic acid (ISO) oltipraz (EXP) orphenadrine (ISO) oxybenzone (ISO) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) phenformin (ISO) phenobarbital (EXP) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) quercetin (ISO) rotenone (ISO) SB 431542 (ISO) senecionine (ISO) sodium arsenite (EXP) tetrachloromethane (EXP,ISO) tetracycline (EXP) trichloroethene (EXP) valproic acid (ISO) vinclozolin (ISO) XAV939 (ISO)
Ugt2a3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 87,472,694 - 87,485,054 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 87,472,831 - 87,485,054 (-) Ensembl GRCm39 Ensembl GRCm38 5 87,324,972 - 87,337,195 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 87,324,972 - 87,337,195 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 87,753,997 - 87,766,220 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 88,399,533 - 88,411,737 (-) NCBI MGSCv36 mm8 Celera 5 84,541,315 - 84,553,528 (-) NCBI Celera Cytogenetic Map 5 E1 NCBI cM Map 5 43.56 NCBI
UGT2A3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 68,928,463 - 68,951,804 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 68,928,463 - 68,951,804 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 69,794,181 - 69,817,522 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 69,828,756 - 69,852,093 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 67,135,540 - 67,158,847 (-) NCBI Celera Cytogenetic Map 4 q13.2 NCBI HuRef 4 65,589,708 - 65,613,015 (-) NCBI HuRef CHM1_1 4 69,830,758 - 69,854,100 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 72,369,135 - 72,392,453 (-) NCBI T2T-CHM13v2.0
Ugt2a3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 20,851,970 - 20,869,974 (+) NCBI GRCr8 mRatBN7.2 14 20,572,793 - 20,590,795 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 20,572,808 - 20,590,729 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 20,762,277 - 20,779,780 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 22,081,193 - 22,098,698 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 20,836,549 - 20,854,042 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 22,251,507 - 22,267,899 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 22,192,970 - 22,619,968 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 22,165,755 - 22,182,147 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 22,099,350 - 22,116,820 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 22,099,349 - 22,116,820 (+) NCBI Celera 14 19,976,311 - 19,993,782 (+) NCBI Celera Cytogenetic Map 14 p21 NCBI
LOC100978938 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 61,009,787 - 61,033,192 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 61,212,686 - 61,236,139 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 55,157,059 - 55,180,507 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 61,613,083 - 61,636,511 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 61,612,932 - 61,636,511 (+) Ensembl panpan1.1 panPan2
UGT2A3 (Canis lupus familiaris - dog)
LOC100624788 (Sus scrofa - pig)
.
Predicted Target Of
Count of predictions: 107 Count of miRNA genes: 100 Interacting mature miRNAs: 104 Transcripts: ENSMUST00000031195 Prediction methods: Miranda Result types: miRGate_prediction
4140990 Lgq6_m late growth QTL 6 (mouse) Not determined 32133234 100777931 Mouse 1301010 ahl2_m age related hearing loss 2 (mouse) Not determined 5 62650568 96650688 Mouse 1301399 Cpfd3_m cerebellum pattern fissures (mouse) Not determined 5 87386871 121387065 Mouse 12910784 Pwgrq15_m post-weaning growth rate QTL 15 (mouse) 5 77175823 97658215 Mouse 1301524 Lmb2_m lupus in MRL and B6 F2 cross (mouse) Not determined 5 37581488 112465722 Mouse 25314315 Mlh1fc4_m MLH1 foci count 4 (mouse) 5 74460661 132528839 Mouse 10045972 Tir5_m trypanosome infection response 5 (mouse) Not determined 5 63705442 104387065 Mouse 1301126 Bwem1_m body weight day 30 males 1 (mouse) Not determined 5 87386871 121387065 Mouse 4141219 W10q16_m weight 10 weeks QTL 16 (mouse) Not determined 32133234 100777931 Mouse 10043962 Obq27_m obesity QTL 27 (mouse) Not determined 5 56285655 90285655 Mouse 12910816 Ogrq2_m overall growth rate QTL 2 (mouse) 5 77175823 97658215 Mouse 1301691 Cdcs10_m cytokine deficiency colitis susceptibility 10 (mouse) Not determined 5 76280786 110280917 Mouse 11041665 Lmr24_m leishmaniasis resistance 24 (mouse) 5 52694462 107321041 Mouse 12738408 Lfibq5_m liver fibrosis QTL 5 (mouse) 5 84783853 89966041 Mouse 1301693 Sle6_m systemic lupus erythematosus susceptibility 6 (mouse) Not determined 5 8890693 87841837 Mouse 10043958 Chldq12_m cholesterol and HDL QTL 12 (mouse) Not determined 5 87386871 121387065 Mouse 26884395 Humsd2_m humerus midshaft diameter 2, 10 week (mouse) 5 70057343 132528839 Mouse 11252124 Modvl6_m modifier of vacuolated lens 6 (mouse) 5 62650568 96650688 Mouse 1301419 Cypr3_m cytokine production 3 (mouse) Not determined 5 81019649 115019803 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 13506928 Recrq8_m recombination rate in male meiosis QTL 8 (mouse) 5 74460661 132528839 Mouse 1301843 Listr1_m listeriosis resistance 1 (mouse) Not determined 5 60246081 94246203 Mouse 10043993 Hbnr10_m Heligmosomoides bakeri nematode resistance 10 (mouse) Not determined 5 72418876 106419011 Mouse 27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 10401246 Bglu13_m blood glucose level 13 (mouse) Not determined 5 79539640 113539786 Mouse 4141438 Skmw13_m skeletal muscle weight 13 (mouse) Not determined 5 76190263 110190479 Mouse 1301713 Dbsty2_m diabesity 2 (mouse) Not determined 5 76445064 110445225 Mouse 11041899 Lmr24a_m leishmaniasis resistance 24a (mouse) 5 52694462 107321041 Mouse 10401245 Bglu18_m blood glucose level 18 (mouse) Not determined 5 82838468 116838597 Mouse 4142064 Tmc1m4_m Tmc1 modifier 4 (mouse) Not determined 5 54500177 127001072 Mouse 1300931 Cocrb6_m cocaine related behavior 6 (mouse) Not determined 5 76445064 110445225 Mouse 4142317 Rgcs1_m retinal ganglion cell susceptible 1 (mouse) Not determined 55388334 108762627 Mouse 1300801 Drb2_m dopamine receptor binding 2 (mouse) Not determined 5 87386871 121387065 Mouse 1301829 Thyls2_m thymic lymphoma susceptibility 2 (mouse) Not determined 5 76445064 110445225 Mouse 12904740 M1fscn2_m modifier 1 of Fscn2 (mouse) 5 66529661 100529661 Mouse 10755524 Mono1_m monocyte differential 1 (mouse) 5 80849259 114849259 Mouse 4142428 Modvl1_m modifier of vacuolated lens 1 (mouse) Not determined 62650568 96650688 Mouse 1357431 Cia27_m collagen induced arthritis 27 (mouse) Not determined 5 75315348 120018629 Mouse 11040589 Lmr3a_m leishmaniasis resistance 3a (mouse) 5 59602801 93602980 Mouse 11040590 Lmr3b_m leishmaniasis resistance 3b (mouse) 5 59602801 93602980 Mouse 11040591 Lmr3c_m leishmaniasis resistance 3c (mouse) 5 59602801 93602980 Mouse 12904739 M2fscn2_m modifier 2 of FSCN2 (mouse) 5 66529661 100529661 Mouse 1301243 Bmd2_m bone mineral density 2 (mouse) Not determined 5 55388334 100455525 Mouse 1300986 Hdlq2_m HDL QTL 2 (mouse) Not determined 5 76280786 110280917 Mouse 11049560 Lmr24d_m leishmaniasis resistance 24d (mouse) 5 64374877 98374996 Mouse 13464249 Ahl16_m age related hearing loss, early onset 16 (mouse) 5 76445064 110445225 Mouse 13464248 Ahl13_m age related hearing loss, early onset 13 (mouse) 5 55645874 89645995 Mouse 13464250 Ahl15_m age related hearing loss, early onset 15 (mouse) 5 62650568 96650688 Mouse 11040592 Lmr3d_m leishmaniasis resistance 3d (mouse) 5 59602801 93602980 Mouse 13464247 Ahl14_m age related hearing loss, early onset 14 (mouse) 5 60403062 94403160 Mouse 4141124 Dshv2_m dorsal hippocampal volume 2 (mouse) Not determined 5 75315348 98019803 Mouse 10044005 Ahl7_m age related hearing loss 7 (mouse) Not determined 5 58330502 92330641 Mouse 13464241 Ahl18_m age related hearing loss, early onset 18 (mouse) 5 87386871 121387065 Mouse 4141505 Chlq14_m circulating hormone level QTL 14 (mouse) Not determined 5 76280786 110280917 Mouse 13464242 Ahl17_m age related hearing loss, early onset 17 (mouse) 5 82838468 116838597 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000031195 ⟹ ENSMUSP00000031195
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 87,472,831 - 87,485,054 (-) Ensembl GRCm38.p6 Ensembl 5 87,324,972 - 87,337,195 (-) Ensembl
RefSeq Acc Id:
NM_028094 ⟹ NP_082370
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 87,472,694 - 87,485,054 (-) NCBI GRCm38 5 87,324,972 - 87,337,195 (-) ENTREZGENE MGSCv37 5 87,753,997 - 87,766,220 (-) RGD Celera 5 84,541,315 - 84,553,528 (-) RGD cM Map 5 ENTREZGENE
Sequence:
AATCTTTGCGAAACAACTTGAGGAGGCACAATATGGTCTCTGAAAAATGTGTTGCGGCATTTTTTCTGCTGCAGCTTTGCTGGGCCGGCTGTGGATTCTGCAGCAAGGTCCTCGTGTGGCCCTGTGAT ATGAGCCACTGGCTGAATCTAAAGACTATTCTTGAGGAGCTTGGAGCAAGAGGGCACGAGGTAACAGTCCTGAAATACCCCAGTATCATCATAGATCAGAGTAAACGTATTCCACTGCACTTTGAGAA TATTCCTTTGCTGTATGAAATCGAGACAGCTGAGAATCGTTTAAATGAGATTGCAAATCTAGCTGTGAATGTCATTCCAAACCTGTCACTGTGGGAAGCAGCAAAAACATTACAAGACTTCTTTCTTC AAGTAACTGGAGATTTTGAAAGTATTTGTAGGAGTGTATTGTACAACCAGAAATTCATGGACAAGCTACGGGATGCACAATATGATGTAGTGGTTATAGACCCTGTCGTTCCCTGTGGAGAGTTGGTG GCAGAAGTGCTTCAGATCCCTTTCGTATACACACTGAGGTTCAGCATGGGCTACTACATGGAGAAACACTGTGGCCAGCTTCCAATTCCACTCTCGTATGTACCGGTTGTCATGAGTGAGCTGACAGA CAATATGACCTTCACAGAGAGGGTGAAAAATATGATGTTTTCACTGTTGTTTGAGTACTGGCTCCAGCAATATGACTTTGCATTCTGGGATCAGTTTTACAGTGAAACCCTAGGAAGGCCCACAACGT TCTGTAAGACTGTGGGGAAAGCTGACATTTGGCTAATCCGAACATATTGGGATGTTGAGTTTCCTCGTCCATATTTACCAAATTTTGAGTTTGTGGGAGGACTGCACTGCAAACCTGCCAAGCCTTTA CCTAAGGAAATGGAAGAATTTGTTCAGAGCTCTGGAGAACATGGTGTAGTAGTATTTTCACTGGGGTCAATGGTCAAAAACCTGACAGAAGAGAAAGCCAACCTCATTGCCTCTGTCCTTGCCCAGAT TCCCCAGAAGGTTTTGTGGAGATACTCAGGCAAGAAGCCAGCCACATTAGGATCCAATACTCGGCTTTTTAATTGGATTCCCCAGAATGATCTTCTTGGACATCCTAAAACCAAAGCTTTCATCACAC ATGGTGGAACAAACGGGATTTATGAAGCCATTTACCATGGGGTCCCTATGGTGGGCGTTCCCATGTTAGGGGATCAGCCTCACAACATCGCTCACATGGAGGCCAAGGGAGCAGCCCTGAAAGTCAGC ATCAGTACAATGACGAGCACAGATTTACTCAGTGCTGTGAGGGCAGTCATTAATGAGCCTTCTTATAAAGAGAATGCCATGCGGTTATCAAGAATCCACCATGATCAGCCAGTGAAGCCCCTGGACCG AGCAGTCTTCTGGATTGAGTTTGTCATGCGTCACAAAGGAGCCAAGCATCTTCGTGTGGCAGCCCATGACCTCAGCTGGTTTCAGTACCACTCCCTAGATGTGATTGGGTTCCTATTGTTGTGTGTCG TTACTCTGACATTCATCATCACTAAATTTTGTTTGTTTGTGTGTCAAAAACTTTATATGAAAGAAAGTAAGAAAATGGGGAACAGAAAGAAAAAGAACTAGGTCTTTTTTAGGTTTGGGAAAGCCCTG AGTGACAATTATATTAACAATCACCACAAGAAGCATGCAACTTCCTGCTTTATACCTATTTTCAAATAAGCAGCTCTGTTTCAGACTGGAAATAAATGTAAACATTAAGCATGATAATTAACTACTGA TTTGTTCCAATCTTCTATCTTGTAGGCATTCTCCTCTCACTCTTCTAAGATATGGAAAATTAATTCTAAATATATTCTATAGAAAGGAAGTGATGAATAACAATATGCTAGACCTCTGGGAAGACATA TAATACCAATCTTATTGATGTATATGAGGATCTCTTACAGTCAATGTCATAAGCCTATCATATTGTCTAAGAACAACCAAAAGAATTTAGTGTGAGAGGGTACTTTTCTAATAAGAAGGAACGTTTCT GTTTTTATAGTGTTGCAGATATTAGAGCATGATTTCTTTTTTATTTTCCAAAAATAATTTATTGAAAAG
hide sequence
RefSeq Acc Id:
NP_082370 ⟸ NM_028094
- Peptide Label:
precursor
- UniProtKB:
Q8R129 (UniProtKB/Swiss-Prot), Q9D811 (UniProtKB/Swiss-Prot), Q8BWQ1 (UniProtKB/Swiss-Prot)
- Sequence:
MVSEKCVAAFFLLQLCWAGCGFCSKVLVWPCDMSHWLNLKTILEELGARGHEVTVLKYPSIIIDQSKRIPLHFENIPLLYEIETAENRLNEIANLAVNVIPNLSLWEAAKTLQDFFLQVTGDFESICR SVLYNQKFMDKLRDAQYDVVVIDPVVPCGELVAEVLQIPFVYTLRFSMGYYMEKHCGQLPIPLSYVPVVMSELTDNMTFTERVKNMMFSLLFEYWLQQYDFAFWDQFYSETLGRPTTFCKTVGKADIW LIRTYWDVEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGEHGVVVFSLGSMVKNLTEEKANLIASVLAQIPQKVLWRYSGKKPATLGSNTRLFNWIPQNDLLGHPKTKAFITHGGTNGIYEAI YHGVPMVGVPMLGDQPHNIAHMEAKGAALKVSISTMTSTDLLSAVRAVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLLCVVTLTFIITKFC LFVCQKLYMKESKKMGNRKKKN
hide sequence
Ensembl Acc Id:
ENSMUSP00000031195 ⟸ ENSMUST00000031195
RGD ID: 6887036
Promoter ID: EPDNEW_M6969
Type: multiple initiation site
Name: Ugt2a3_1
Description: Mus musculus UDP glucuronosyltransferase 2 family, polypeptideA3 , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 87,337,195 - 87,337,255 EPDNEW
RGD ID: 6838584
Promoter ID: MM_KWN:42755
Type: Non-CpG
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: Liver
Transcripts: NM_028094
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 87,765,806 - 87,766,306 (-) MPROMDB