Symbol:
Vac14
Name:
Vac14 homolog (S. cerevisiae)
RGD ID:
1551146
MGI Page
MGI
Description:
Predicted to enable identical protein binding activity and kinase activator activity. Involved in regulation of postsynaptic neurotransmitter receptor internalization. Is active in presynaptic endosome. Is expressed in cerebral cortex ventricular layer; cortical plate; embryo; and extraembryonic component. Human ortholog(s) of this gene implicated in striatonigral degeneration. Orthologous to human VAC14 (VAC14 component of PIKFYVE complex).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AA959718; BC032215; D8Wsu151; D8Wsu151e; i; ingls; MGC38230; protein VAC14 homolog; Tax1 (human T-cell leukemia virus type I) binding protein 1; Tax1 (human T-cell leukemia virus type I) binding protein 2; Tax1b; Tax1bp2; Tr; Trx; vacuole morphology 14; vacuole morphology 14 (yeast)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VAC14 (VAC14 component of PIKFYVE complex) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Vac14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vac14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VAC14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VAC14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vac14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VAC14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VAC14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vac14 (VAC14 component of PIKFYVE complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Vac14 (VAC14 component of PIKFYVE complex)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
VAC14 (VAC14 component of PIKFYVE complex)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vac14 (vac14 homolog (S. cerevisiae))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5608
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
VAC14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
vacl-14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
vac14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mrpl47
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 111,345,161 - 111,447,030 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 111,345,217 - 111,447,030 (+) Ensembl GRCm39 Ensembl GRCm38 8 110,618,529 - 110,720,398 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 110,618,585 - 110,720,398 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 113,142,538 - 113,244,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 113,505,315 - 113,607,075 (+) NCBI MGSCv36 mm8 Celera 8 114,842,345 - 114,944,148 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 57.59 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vac14 Mouse (+)-catechin multiple interactions ISO VAC14 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of VAC14 mRNA CTD PMID:24763279 Vac14 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VAC14 mRNA CTD PMID:36331819 Vac14 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of VAC14 mRNA CTD PMID:28960355 Vac14 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of VAC14 mRNA CTD PMID:22206623 Vac14 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of VAC14 mRNA CTD PMID:39298647 Vac14 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of VAC14 mRNA CTD PMID:19770486 Vac14 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Vac14 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of VAC14 mRNA CTD PMID:33387578 Vac14 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of VAC14 mRNA CTD PMID:21570461 Vac14 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Vac14 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Vac14 Mouse 2,6-dinitrotoluene affects expression ISO Vac14 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of VAC14 mRNA CTD PMID:21346803 Vac14 Mouse 2-bromohexadecanoic acid multiple interactions ISO VAC14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of VAC14 protein] CTD PMID:38195004 Vac14 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of VAC14 mRNA CTD PMID:20188158 Vac14 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO VAC14 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VAC14 mRNA CTD PMID:28628672 Vac14 Mouse 4,4'-sulfonyldiphenol increases expression ISO VAC14 (Homo sapiens) 6480464 bisphenol S results in increased expression of VAC14 protein CTD PMID:34186270 Vac14 Mouse aflatoxin B1 affects methylation ISO VAC14 (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of VAC14 intron CTD PMID:30157460 Vac14 Mouse Aflatoxin B2 alpha decreases methylation ISO VAC14 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of VAC14 intron CTD PMID:30157460 Vac14 Mouse ammonium chloride affects expression ISO Vac14 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of VAC14 mRNA CTD PMID:16483693 Vac14 Mouse arsane affects methylation ISO VAC14 (Homo sapiens) 6480464 Arsenic affects the methylation of VAC14 gene CTD PMID:25304211 Vac14 Mouse arsenic atom affects methylation ISO VAC14 (Homo sapiens) 6480464 Arsenic affects the methylation of VAC14 gene CTD PMID:25304211 Vac14 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of VAC14 protein CTD PMID:37955338 Vac14 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of VAC14 mRNA CTD PMID:22228805 Vac14 Mouse benzo[a]pyrene decreases expression ISO VAC14 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of VAC14 mRNA CTD PMID:20064835 and PMID:26238291 Vac14 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO VAC14 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Vac14 Mouse benzo[e]pyrene decreases methylation ISO VAC14 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of VAC14 intron CTD PMID:30157460 Vac14 Mouse beta-lapachone increases expression ISO VAC14 (Homo sapiens) 6480464 beta-lapachone results in increased expression of VAC14 mRNA CTD PMID:38218311 Vac14 Mouse bisphenol A affects expression ISO Vac14 (Rattus norvegicus) 6480464 bisphenol A affects the expression of VAC14 mRNA CTD PMID:25181051 Vac14 Mouse bisphenol A decreases expression ISO Vac14 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of VAC14 mRNA CTD PMID:34947998 Vac14 Mouse bisphenol A increases expression ISO VAC14 (Homo sapiens) 6480464 bisphenol A results in increased expression of VAC14 mRNA and bisphenol A results in increased expression of VAC14 protein CTD PMID:29275510 and PMID:34186270 Vac14 Mouse bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of VAC14 promoter CTD PMID:27312807 Vac14 Mouse bisphenol A multiple interactions ISO VAC14 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VAC14 mRNA CTD PMID:28628672 Vac14 Mouse bisphenol A increases methylation ISO Vac14 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of VAC14 gene CTD PMID:28505145 Vac14 Mouse bisphenol AF increases expression ISO VAC14 (Homo sapiens) 6480464 bisphenol AF results in increased expression of VAC14 protein CTD PMID:34186270 Vac14 Mouse Bisphenol B increases expression ISO VAC14 (Homo sapiens) 6480464 bisphenol B results in increased expression of VAC14 protein CTD PMID:34186270 Vac14 Mouse bisphenol F increases expression ISO VAC14 (Homo sapiens) 6480464 bisphenol F results in increased expression of VAC14 protein CTD PMID:34186270 Vac14 Mouse cadmium atom multiple interactions ISO VAC14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of VAC14 protein] more ... CTD PMID:35301059 and PMID:38195004 Vac14 Mouse cadmium dichloride multiple interactions ISO VAC14 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of VAC14 protein] more ... CTD PMID:35301059 and PMID:38195004 Vac14 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Vac14 Mouse cobalt dichloride decreases expression ISO VAC14 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of VAC14 mRNA CTD PMID:19320972 Vac14 Mouse copper atom multiple interactions EXP 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of VAC14 mRNA CTD PMID:15467011 Vac14 Mouse copper(0) multiple interactions EXP 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of VAC14 mRNA CTD PMID:15467011 Vac14 Mouse copper(II) sulfate decreases expression ISO VAC14 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of VAC14 mRNA CTD PMID:19549813 Vac14 Mouse cylindrospermopsin increases expression ISO VAC14 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of VAC14 mRNA CTD PMID:24921660 Vac14 Mouse dexamethasone multiple interactions ISO VAC14 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VAC14 mRNA CTD PMID:28628672 Vac14 Mouse dicrotophos increases expression ISO VAC14 (Homo sapiens) 6480464 dicrotophos results in increased expression of VAC14 mRNA CTD PMID:28302478 Vac14 Mouse doxorubicin decreases expression ISO VAC14 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of VAC14 mRNA CTD PMID:29803840 Vac14 Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of VAC14 mRNA CTD PMID:35436446 Vac14 Mouse flutamide increases expression ISO Vac14 (Rattus norvegicus) 6480464 Flutamide results in increased expression of VAC14 mRNA CTD PMID:24136188 Vac14 Mouse FR900359 decreases phosphorylation ISO VAC14 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of VAC14 protein CTD PMID:37730182 Vac14 Mouse gentamycin increases expression ISO Vac14 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of VAC14 mRNA CTD PMID:33387578 Vac14 Mouse hydrogen peroxide affects expression ISO VAC14 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of VAC14 mRNA CTD PMID:20044591 Vac14 Mouse indometacin multiple interactions ISO VAC14 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of VAC14 mRNA CTD PMID:28628672 Vac14 Mouse ivermectin decreases expression ISO VAC14 (Homo sapiens) 6480464 Ivermectin results in decreased expression of VAC14 protein CTD PMID:32959892 Vac14 Mouse methapyrilene decreases methylation ISO VAC14 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of VAC14 intron CTD PMID:30157460 Vac14 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of VAC14 mRNA CTD PMID:35964746 Vac14 Mouse perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of VAC14 protein CTD PMID:26178269 Vac14 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VAC14 mRNA CTD PMID:36331819 Vac14 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of VAC14 mRNA CTD PMID:18301758 Vac14 Mouse rotenone increases expression ISO Vac14 (Rattus norvegicus) 6480464 Rotenone results in increased expression of VAC14 mRNA CTD PMID:28374803 Vac14 Mouse SB 431542 multiple interactions ISO VAC14 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of VAC14 protein CTD PMID:37664457 Vac14 Mouse silicon dioxide decreases expression ISO VAC14 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of VAC14 mRNA CTD PMID:25895662 Vac14 Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of VAC14 protein CTD PMID:28918527 Vac14 Mouse temozolomide decreases expression ISO VAC14 (Homo sapiens) 6480464 Temozolomide results in decreased expression of VAC14 mRNA CTD PMID:31758290 Vac14 Mouse thapsigargin decreases expression ISO Vac14 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of VAC14 protein CTD PMID:35544339 Vac14 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of VAC14 promoter CTD PMID:35295148 Vac14 Mouse triphenyl phosphate affects expression ISO VAC14 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of VAC14 mRNA CTD PMID:37042841 Vac14 Mouse valproic acid increases methylation ISO VAC14 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of VAC14 gene CTD PMID:29154799
Imported Annotations - SMPDB
(+)-catechin (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dinitrotoluene (ISO) 2-bromohexadecanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cylindrospermopsin (ISO) dexamethasone (ISO) dicrotophos (ISO) doxorubicin (ISO) epoxiconazole (EXP) flutamide (ISO) FR900359 (ISO) gentamycin (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) methapyrilene (ISO) nitrates (EXP) perfluorooctane-1-sulfonic acid (EXP) pirinixic acid (EXP) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium fluoride (EXP) temozolomide (ISO) thapsigargin (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) valproic acid (ISO)
Vac14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 111,345,161 - 111,447,030 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 111,345,217 - 111,447,030 (+) Ensembl GRCm39 Ensembl GRCm38 8 110,618,529 - 110,720,398 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 110,618,585 - 110,720,398 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 113,142,538 - 113,244,298 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 113,505,315 - 113,607,075 (+) NCBI MGSCv36 mm8 Celera 8 114,842,345 - 114,944,148 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 57.59 NCBI
VAC14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 70,687,439 - 70,801,158 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 70,687,439 - 70,801,160 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 70,721,342 - 70,835,061 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 69,278,843 - 69,392,562 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 69,278,844 - 69,392,562 NCBI Celera 16 54,687,481 - 54,803,215 (+) NCBI Celera Cytogenetic Map 16 q22.1-q22.2 NCBI HuRef 16 56,552,837 - 56,666,566 (-) NCBI HuRef CHM1_1 16 72,128,694 - 72,242,416 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 76,498,610 - 76,612,330 (-) NCBI T2T-CHM13v2.0
Vac14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 55,499,962 - 55,601,290 (+) NCBI GRCr8 mRatBN7.2 19 38,590,569 - 38,691,911 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 38,590,569 - 38,691,909 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 45,396,503 - 45,497,671 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 46,049,874 - 46,151,038 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 48,360,269 - 48,461,568 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 40,927,007 - 41,029,206 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 40,927,007 - 41,029,206 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 51,753,772 - 51,855,971 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 40,538,392 - 40,639,758 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 40,543,272 - 40,644,637 (+) NCBI Celera 19 37,985,831 - 38,087,096 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
Vac14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 3,451,016 - 3,557,824 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 3,451,187 - 3,557,471 (-) NCBI ChiLan1.0 ChiLan1.0
VAC14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 83,365,110 - 83,478,896 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 89,298,744 - 89,412,522 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 54,216,303 - 54,330,073 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 70,520,440 - 70,634,152 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 70,520,440 - 70,634,143 (-) Ensembl panpan1.1 panPan2
VAC14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 76,635,931 - 76,737,414 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 76,636,355 - 76,737,353 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 76,596,687 - 76,696,623 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 77,072,565 - 77,173,409 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 77,072,570 - 77,173,703 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 76,894,317 - 76,995,070 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 76,716,769 - 76,817,393 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 77,208,877 - 77,309,628 (-) NCBI UU_Cfam_GSD_1.0
Vac14 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 36,644,434 - 36,746,811 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 22,842,248 - 22,944,690 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 22,842,333 - 22,944,680 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VAC14 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 13,683,801 - 13,791,241 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 13,683,800 - 13,791,246 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 13,797,010 - 13,819,469 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VAC14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 53,829,168 - 53,944,178 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 53,828,117 - 53,944,136 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 16,641,321 - 16,756,343 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vac14
.
Predicted Target Of
Count of predictions: 270 Count of miRNA genes: 220 Interacting mature miRNAs: 246 Transcripts: ENSMUST00000034190 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300560 Tgl1_m triglyceride level 1 (mouse) Not determined 8 102486208 111650036 Mouse 4141435 Fbtq3_m femoral bone trait QTL 3 (mouse) Not determined 8 100965309 130127694 Mouse 35673316 Ari3_m antibody response to influenza 3, day 15, IgM (mouse) 8 109426632 113826632 Mouse 11252141 Fdr2_m fat response to dietary restriction 2 (mouse) 8 98390634 130127694 Mouse 1302105 Im1_m Immunoregulatory 1 (mouse) Not determined 8 99828531 130127694 Mouse 1301080 Sluc9_m susceptibility to lung cancer 9 (mouse) Not determined 8 99828531 130127694 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 36049782 Arc2_m antibody response to CHIKV 2, day 7, IgM (mouse) 8 109426632 113826632 Mouse 36049783 Arc3_m antibody response to CHIKV 3, day 7, FRNT50 (mouse) 8 109426632 113826632 Mouse 36049780 Ars12_m antibody response to SARS-CoV 12, 4 days post-rechallenge, IgM (mouse) 8 109426632 113826632 Mouse 14746994 Manh65_m mandible shape 65 (mouse) 8 106489629 130127694 Mouse 36049781 Arc1_m antibody response to CHIKV 1, day 7, IgG (mouse) 8 109426632 113826632 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 1301316 Dntcs1_m dental caries susceptibility 1 (mouse) Not determined 8 103443553 127781786 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 1300681 Pgia22_m proteoglycan induced arthritis 22 (mouse) Not determined 8 102486208 116025457 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1357494 Obsty2_m obesity 2 (mouse) Not determined 8 96245241 129745061 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 12880431 Fgf23lq2_m FGF23 serum level QTL 2 (mouse) 8 97626632 130127694 Mouse 10412274 Leci1_m leukocyte endothelial cell interactions 1 (mouse) Not determined 8 110415083 130127694 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 10412273 Fcd1_m functional capillary density 1 (mouse) Not determined 8 110415083 130127694 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 11079194 Tpnr6_m thermal pain response 6 (mouse) 8 111166632 114956740 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1301481 Lith11_m lithogenic gene 11 (mouse) Not determined 8 98563635 130127694 Mouse 11532692 Sluc38a_m susceptibility to lung cancer 38a (mouse) 8 105033977 130127694 Mouse 11532691 Sluc38_m susceptibility to lung cancer 38 (mouse) 8 105033977 130127694 Mouse
AA959718
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 110,720,088 - 110,720,208 UniSTS GRCm38 MGSCv37 8 113,243,988 - 113,244,108 UniSTS GRCm37 Celera 8 114,943,838 - 114,943,958 UniSTS Cytogenetic Map 8 E1 UniSTS cM Map 8 53.5 UniSTS Whitehead/MRC_RH 8 1305.99 UniSTS
RH125289
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 110,689,577 - 110,689,664 UniSTS GRCm38 MGSCv37 8 113,213,477 - 113,213,564 UniSTS GRCm37 Celera 8 114,913,283 - 114,913,370 UniSTS Cytogenetic Map 8 E1 UniSTS cM Map 8 53.5 UniSTS
UniSTS:224576
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 110,689,612 - 110,689,688 UniSTS GRCm38 MGSCv37 8 113,213,512 - 113,213,588 UniSTS GRCm37 Celera 8 114,913,318 - 114,913,394 UniSTS Cytogenetic Map 8 E1 UniSTS cM Map 8 53.5 UniSTS
RH125769
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 110,720,100 - 110,720,349 UniSTS GRCm38 MGSCv37 8 113,244,000 - 113,244,249 UniSTS GRCm37 Celera 8 114,943,850 - 114,944,099 UniSTS Cytogenetic Map 8 E1 UniSTS cM Map 8 53.5 UniSTS Whitehead/MRC_RH 8 1310.47 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034190 ⟹ ENSMUSP00000034190
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,345,231 - 111,447,030 (+) Ensembl GRCm38.p6 Ensembl 8 110,618,599 - 110,720,398 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212663
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,345,235 - 111,441,011 (+) Ensembl GRCm38.p6 Ensembl 8 110,618,603 - 110,714,379 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212766
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,345,240 - 111,437,315 (+) Ensembl GRCm38.p6 Ensembl 8 110,618,608 - 110,710,683 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212829 ⟹ ENSMUSP00000148548
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,345,244 - 111,447,026 (+) Ensembl GRCm38.p6 Ensembl 8 110,618,612 - 110,720,394 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000213003 ⟹ ENSMUSP00000148440
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,345,217 - 111,447,028 (+) Ensembl GRCm38.p6 Ensembl 8 110,618,585 - 110,720,396 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000213015
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 111,372,212 - 111,439,578 (+) Ensembl GRCm38.p6 Ensembl 8 110,645,580 - 110,712,946 (+) Ensembl
RefSeq Acc Id:
NM_146216 ⟹ NP_666328
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,199 - 111,447,030 (+) NCBI GRCm38 8 110,618,567 - 110,720,398 (+) NCBI MGSCv37 8 113,142,538 - 113,244,298 (+) RGD Celera 8 114,842,345 - 114,944,148 (+) RGD cM Map 8 ENTREZGENE
Sequence:
GGTCGGCGGAAGGCGGAAGTGCTCGCGGCGTCACGTGACCTGAGTAACATGGCCGCGGCCCAGTGAGCGTTGCCGGTTCCTGGCGGGAGCTGGTCGCGTGAGCCGTGGGGCGGACCGGGTCGCGCGTG
hide sequence
RefSeq Acc Id:
NR_151674
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,199 - 111,447,030 (+) NCBI GRCm38 8 110,618,567 - 110,720,398 (+) NCBI
Sequence:
GGTCGGCGGAAGGCGGAAGTGCTCGCGGCGTCACGTGACCTGAGTAACATGGCCGCGGCCCAGT
hide sequence
RefSeq Acc Id:
NR_151675
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,199 - 111,447,030 (+) NCBI GRCm38 8 110,618,567 - 110,720,398 (+) NCBI
Sequence:
GGTCGGCGGAAGGCGGAAGTGCTCGCGGCGTCACGTGACCTGAGTAACATGGCCGCGGCCCAGT
hide sequence
RefSeq Acc Id:
XM_006530918 ⟹ XP_006530981
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,161 - 111,447,030 (+) NCBI GRCm38 8 110,618,529 - 110,720,398 (+) NCBI
Sequence:
AAGCACGAGAGGGCGTGGCCTGGGGGGGCGGAACCTTCGGTCGGCGGAAGGCGGAAGTGCTCGC
hide sequence
RefSeq Acc Id:
XR_003947268
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,161 - 111,446,836 (+) NCBI GRCm38 8 110,618,529 - 110,720,204 (+) NCBI
Sequence:
AAGCACGAGAGGGCGTGGCCTGGGGGGGCGGAACCTTCGGTCGGCGGAAGGCGGAAGTGCTCGCGGCGTCACGTGACCTGAGTAACATGGCCGCGGCCCAGTGAGCGTTGCCGGTTCCTGGCGGGAGC
hide sequence
RefSeq Acc Id:
XR_003947269
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 111,345,161 - 111,437,088 (+) NCBI GRCm38 8 110,618,529 - 110,710,456 (+) NCBI
Sequence:
AAGCACGAGAGGGCGTGGCCTGGGGGGGCGGAACCTTCGGTCGGCGGAAGGCGGAAGTGCTCGC
hide sequence
RefSeq Acc Id:
NP_666328 ⟸ NM_146216
- UniProtKB:
Q8C8K8 (UniProtKB/Swiss-Prot), Q80WQ2 (UniProtKB/Swiss-Prot), Q3TAX7 (UniProtKB/Swiss-Prot), Q8CCX6 (UniProtKB/TrEMBL)
- Sequence:
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVRDFVAQNNTMQIKHVIQTLSQEFALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNIVKVARGAV
hide sequence
RefSeq Acc Id:
XP_006530981 ⟸ XM_006530918
- Peptide Label:
isoform X1
- UniProtKB:
Q8CCX6 (UniProtKB/TrEMBL)
- Sequence:
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVRDFVAQNNTMQIKHVIQTLSQEFALSQ
hide sequence
Ensembl Acc Id:
ENSMUSP00000034190 ⟸ ENSMUST00000034190
Ensembl Acc Id:
ENSMUSP00000148440 ⟸ ENSMUST00000213003
Ensembl Acc Id:
ENSMUSP00000148548 ⟸ ENSMUST00000212829
RGD ID: 8668267 Promoter ID: EPDNEW_M12165 Type: multiple initiation site Name: Vac14_1 Description: Mus musculus Vac14 homolog , transcript variant 3, non-codingRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 110,618,599 - 110,618,659 EPDNEW
RGD ID: 6843870 Promoter ID: MM_KWN:55734 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4 Transcripts: ENSMUST00000034190, UC009NKU.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 113,142,276 - 113,142,776 (+) MPROMDB
RGD ID: 6848359 Promoter ID: MM_ACW:48868 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: VAC14.LSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 113,235,244 - 113,235,744 (+) MPROMDB
RGD ID: 6843871 Promoter ID: MM_KWN:55735 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, Kidney, Lung Transcripts: UC009NKW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 113,238,766 - 113,239,417 (+) MPROMDB
RGD ID: 6848353 Promoter ID: MM_ACW:48870 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_4Hour, Liver, Lung, Spleen Transcripts: VAC14.KSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 113,242,979 - 113,243,479 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-09-25
Vac14
Vac14 homolog (S. cerevisiae)
Vac14
vacuole morphology 14 (yeast)
Symbol and/or name change
5135510 APPROVED
2024-08-21
Vac14
vacuole morphology 14 (yeast)
Vac14
Vac14 homolog (S. cerevisiae)
Symbol and/or name change
5135510 APPROVED
