Symbol:
Cntfr
Name:
ciliary neurotrophic factor receptor
RGD ID:
1550710
MGI Page
MGI
Description:
Enables ciliary neurotrophic factor receptor activity. Acts upstream of or within several processes, including ciliary neurotrophic factor-mediated signaling pathway; negative regulation of motor neuron apoptotic process; and suckling behavior. Predicted to be located in apical plasma membrane. Predicted to be part of CNTFR-CLCF1 complex and ciliary neurotrophic factor receptor complex. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including central nervous system; lung; metanephros; sensory organ; and skeletal musculature. Orthologous to human CNTFR (ciliary neurotrophic factor receptor).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ciliary neurotrophic factor receptor subunit alpha; Cntf; CNTF receptor subunit alpha; CNTFR-alpha; Cntfralpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CNTFR (ciliary neurotrophic factor receptor) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cntfr (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cntfr (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CNTFR (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CNTFR (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cntfr (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CNTFR (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CNTFR (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cntfr (ciliary neurotrophic factor receptor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cntfr (ciliary neurotrophic factor receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CNTFR (ciliary neurotrophic factor receptor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cntfr (ciliary neurotrophic factor receptor)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
cntfr
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 41,657,498 - 41,697,091 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 41,657,498 - 41,697,089 (-) Ensembl GRCm39 Ensembl GRCm38 4 41,657,498 - 41,697,091 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 41,657,498 - 41,697,089 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 41,604,529 - 41,644,123 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 41,846,167 - 41,885,712 (-) NCBI MGSCv36 mm8 Celera 4 41,319,986 - 41,355,439 (-) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 21.81 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cntfr Mouse 1-naphthyl isothiocyanate decreases expression ISO Cntfr (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of CNTFR mRNA CTD PMID:30723492 Cntfr Mouse 17beta-estradiol increases expression ISO Cntfr (Rattus norvegicus) 6480464 Estradiol results in increased expression of CNTFR mRNA CTD PMID:20068009 Cntfr Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CNTFR mRNA CTD PMID:39298647 Cntfr Mouse 17beta-estradiol multiple interactions ISO CNTFR (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CNTFR mRNA CTD PMID:30165855 Cntfr Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CNTFR mRNA CTD PMID:21570461 Cntfr Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cntfr (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CNTFR mRNA CTD PMID:33387578 Cntfr Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Cntfr (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 Cntfr Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of CNTFR promoter CTD PMID:33297965 Cntfr Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of CNTFR mRNA CTD PMID:39298647 Cntfr Mouse 5-aza-2'-deoxycytidine affects expression ISO CNTFR (Homo sapiens) 6480464 Decitabine affects the expression of CNTFR mRNA CTD PMID:23300844 Cntfr Mouse acetamide increases expression ISO Cntfr (Rattus norvegicus) 6480464 acetamide results in increased expression of CNTFR mRNA CTD PMID:31881176 Cntfr Mouse acrylamide affects expression ISO Cntfr (Rattus norvegicus) 6480464 Acrylamide affects the expression of CNTFR mRNA CTD PMID:28959563 Cntfr Mouse acrylamide decreases expression ISO CNTFR (Homo sapiens) 6480464 Acrylamide results in decreased expression of CNTFR mRNA CTD PMID:32763439 Cntfr Mouse aflatoxin B1 decreases methylation ISO CNTFR (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CNTFR gene CTD PMID:27153756 Cntfr Mouse ammonium chloride affects expression ISO Cntfr (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of CNTFR mRNA CTD PMID:16483693 Cntfr Mouse arsane decreases expression ISO CNTFR (Homo sapiens) 6480464 Arsenic results in decreased expression of CNTFR mRNA CTD PMID:36861143 Cntfr Mouse arsenic atom decreases expression ISO CNTFR (Homo sapiens) 6480464 Arsenic results in decreased expression of CNTFR mRNA CTD PMID:36861143 Cntfr Mouse atrazine increases expression ISO CNTFR (Homo sapiens) 6480464 Atrazine results in increased expression of CNTFR mRNA CTD PMID:22378314 Cntfr Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CNTFR mRNA CTD PMID:29950665 Cntfr Mouse benzo[a]pyrene affects methylation ISO CNTFR (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CNTFR 5' UTR CTD PMID:27901495 Cntfr Mouse benzo[a]pyrene decreases methylation ISO CNTFR (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CNTFR promoter CTD PMID:27901495 Cntfr Mouse benzo[e]pyrene increases methylation ISO CNTFR (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CNTFR intron CTD PMID:30157460 Cntfr Mouse bis(2-ethylhexyl) phthalate decreases expression ISO CNTFR (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of CNTFR mRNA CTD PMID:31163220 Cntfr Mouse bisphenol A affects expression ISO Cntfr (Rattus norvegicus) 6480464 bisphenol A affects the expression of CNTFR mRNA CTD PMID:25181051 Cntfr Mouse bisphenol A increases expression ISO CNTFR (Homo sapiens) 6480464 bisphenol A results in increased expression of CNTFR mRNA CTD PMID:27685785 Cntfr Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of CNTFR mRNA CTD PMID:38685157 Cntfr Mouse cadmium atom multiple interactions ISO CNTFR (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CNTFR mRNA CTD PMID:35301059 Cntfr Mouse cadmium dichloride decreases methylation ISO Cntfr (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased methylation of CNTFR promoter CTD PMID:22457795 Cntfr Mouse cadmium dichloride multiple interactions ISO CNTFR (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CNTFR mRNA CTD PMID:35301059 Cntfr Mouse capsaicin multiple interactions ISO Cntfr (Rattus norvegicus) 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CNTFR protein] more ... CTD PMID:22150557 Cntfr Mouse capsaicin increases expression ISO Cntfr (Rattus norvegicus) 6480464 Capsaicin results in increased expression of CNTFR protein CTD PMID:22150557 Cntfr Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of CNTFR mRNA CTD PMID:25554681 Cntfr Mouse CGP 52608 multiple interactions ISO CNTFR (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CNTFR gene] CTD PMID:28238834 Cntfr Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of CNTFR mRNA CTD PMID:32715474 Cntfr Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of CNTFR mRNA CTD PMID:37019170 Cntfr Mouse cisplatin affects expression ISO CNTFR (Homo sapiens) 6480464 Cisplatin affects the expression of CNTFR mRNA CTD PMID:23300844 Cntfr Mouse cytarabine increases expression ISO CNTFR (Homo sapiens) 6480464 Cytarabine results in increased expression of CNTFR mRNA CTD PMID:21198554 Cntfr Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CNTFR mRNA CTD PMID:29950665 Cntfr Mouse dimethylarsinic acid decreases expression ISO Cntfr (Rattus norvegicus) 6480464 Cacodylic Acid results in decreased expression of CNTFR mRNA CTD PMID:37567419 Cntfr Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of CNTFR mRNA CTD PMID:30319688 Cntfr Mouse ethylparaben decreases expression ISO CNTFR (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of CNTFR mRNA CTD PMID:37690743 Cntfr Mouse fenvalerate increases expression ISO Cntfr (Rattus norvegicus) 6480464 fenvalerate results in increased expression of CNTFR mRNA CTD PMID:30307764 Cntfr Mouse formaldehyde decreases expression ISO CNTFR (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CNTFR mRNA CTD PMID:27905399 Cntfr Mouse genistein increases expression EXP 6480464 Genistein results in increased expression of CNTFR mRNA CTD PMID:32186404 Cntfr Mouse gentamycin increases expression ISO Cntfr (Rattus norvegicus) 6480464 Gentamicins results in increased expression of CNTFR mRNA CTD PMID:33387578 Cntfr Mouse GW 4064 increases expression EXP 6480464 GW 4064 results in increased expression of CNTFR mRNA CTD PMID:26655953 Cntfr Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of CNTFR mRNA CTD PMID:26307267 Cntfr Mouse methapyrilene increases methylation ISO CNTFR (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CNTFR intron CTD PMID:30157460 Cntfr Mouse methoxychlor affects methylation ISO Cntfr (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of CNTFR gene CTD PMID:35440735 Cntfr Mouse N-methyl-4-phenylpyridinium multiple interactions ISO CNTFR (Homo sapiens) 6480464 [RHEB protein mutant form results in increased expression of CNTFR protein] which results in decreased susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:25799580 Cntfr Mouse naproxen multiple interactions ISO Cntfr (Rattus norvegicus) 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CNTFR protein] and Naproxen inhibits the reaction [Capsaicin results in increased expression of CNTFR protein] CTD PMID:22150557 Cntfr Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CNTFR mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CNTFR mRNA CTD PMID:34911549 Cntfr Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CNTFR mRNA CTD PMID:17562736 Cntfr Mouse paracetamol increases expression ISO Cntfr (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of CNTFR mRNA CTD PMID:33387578 Cntfr Mouse paraquat decreases expression ISO Cntfr (Rattus norvegicus) 6480464 Paraquat results in decreased expression of CNTFR mRNA CTD PMID:32680482 Cntfr Mouse perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of CNTFR mRNA CTD PMID:37315490 Cntfr Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of CNTFR mRNA CTD PMID:19136022 Cntfr Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of CNTFR mRNA CTD PMID:19136022 Cntfr Mouse potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of CNTFR mRNA CTD PMID:23608068 Cntfr Mouse SB 431542 multiple interactions ISO CNTFR (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CNTFR protein CTD PMID:37664457 Cntfr Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of CNTFR mRNA CTD PMID:21795629 Cntfr Mouse sodium arsenite increases expression ISO CNTFR (Homo sapiens) 6480464 sodium arsenite results in increased expression of CNTFR mRNA CTD PMID:29301061 Cntfr Mouse sumatriptan multiple interactions ISO Cntfr (Rattus norvegicus) 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin results in increased expression of CNTFR protein] and Sumatriptan inhibits the reaction [Capsaicin results in increased expression of CNTFR protein] CTD PMID:22150557 Cntfr Mouse sunitinib decreases expression ISO CNTFR (Homo sapiens) 6480464 Sunitinib results in decreased expression of CNTFR mRNA CTD PMID:31533062 Cntfr Mouse thapsigargin increases expression ISO Cntfr (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of CNTFR protein CTD PMID:35544339 Cntfr Mouse thioacetamide decreases expression ISO Cntfr (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of CNTFR mRNA CTD PMID:34492290 Cntfr Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of CNTFR mRNA CTD PMID:29264374 Cntfr Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CNTFR mRNA CTD PMID:35295148 Cntfr Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CNTFR mRNA CTD PMID:29950665 Cntfr Mouse toluene increases expression ISO Cntfr (Rattus norvegicus) 6480464 Toluene results in increased expression of CNTFR mRNA CTD PMID:22967744 Cntfr Mouse valproic acid increases methylation ISO CNTFR (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CNTFR gene CTD PMID:29154799 Cntfr Mouse XL147 multiple interactions EXP 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of CNTFR mRNA CTD PMID:27935865
Imported Annotations - KEGG (archival)
1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) acetamide (ISO) acrylamide (ISO) aflatoxin B1 (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) Azoxymethane (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) capsaicin (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) cisplatin (ISO) cytarabine (ISO) dextran sulfate (EXP) dimethylarsinic acid (ISO) ethanol (EXP) ethylparaben (ISO) fenvalerate (ISO) formaldehyde (ISO) genistein (EXP) gentamycin (ISO) GW 4064 (EXP) methamphetamine (EXP) methapyrilene (ISO) methoxychlor (ISO) N-methyl-4-phenylpyridinium (ISO) naproxen (ISO) ozone (EXP) paracetamol (EXP,ISO) paraquat (ISO) perfluorohexanesulfonic acid (EXP) phenobarbital (EXP) pirinixic acid (EXP) potassium dichromate (EXP) SB 431542 (ISO) sodium arsenate (EXP) sodium arsenite (ISO) sumatriptan (ISO) sunitinib (ISO) thapsigargin (ISO) thioacetamide (ISO) titanium dioxide (EXP) toluene (ISO) valproic acid (ISO) XL147 (EXP)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
MGDs mouse GO annotations
MGD data from the GO Consortium
3.
MGD IEA
MGD IEA
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Receptor tyrosine kinase specific for the skeletal muscle lineage: expression in embryonic muscle, at the neuromuscular junction, and after injury.
Valenzuela DM, etal., Neuron 1995 Sep;15(3):573-84.
Cntfr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 41,657,498 - 41,697,091 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 41,657,498 - 41,697,089 (-) Ensembl GRCm39 Ensembl GRCm38 4 41,657,498 - 41,697,091 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 41,657,498 - 41,697,089 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 41,604,529 - 41,644,123 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 41,846,167 - 41,885,712 (-) NCBI MGSCv36 mm8 Celera 4 41,319,986 - 41,355,439 (-) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 21.81 NCBI
CNTFR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 34,551,433 - 34,590,852 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 34,551,432 - 34,590,140 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 34,551,431 - 34,590,157 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 34,541,431 - 34,579,722 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 34,541,430 - 34,579,722 NCBI Celera 9 34,482,940 - 34,521,225 (-) NCBI Celera Cytogenetic Map 9 p13.3 NCBI HuRef 9 34,505,791 - 34,566,338 (-) NCBI HuRef CHM1_1 9 34,551,220 - 34,589,921 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 34,569,984 - 34,609,005 (-) NCBI T2T-CHM13v2.0
Cntfr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 61,619,326 - 61,657,359 (-) NCBI GRCr8 mRatBN7.2 5 56,823,448 - 56,861,049 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 56,823,965 - 56,841,392 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 58,803,485 - 58,832,001 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 60,622,311 - 60,650,828 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 60,608,710 - 60,637,223 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 58,041,114 - 58,078,687 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 58,041,146 - 58,078,545 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 62,566,649 - 62,594,369 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 5 55,418,121 - 55,446,426 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
Cntfr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955472 1,540,973 - 1,579,947 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955472 1,540,973 - 1,577,734 (+) NCBI ChiLan1.0 ChiLan1.0
CNTFR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 90,013,433 - 90,052,344 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 90,019,374 - 90,058,284 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 34,387,929 - 34,426,907 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 35,197,474 - 35,236,234 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 35,197,474 - 35,214,977 (-) Ensembl panpan1.1 panPan2
CNTFR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 51,226,951 - 51,266,431 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 51,227,509 - 51,245,188 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 49,856,718 - 49,885,981 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 52,168,591 - 52,207,166 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 52,156,483 - 52,206,853 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 50,831,810 - 50,861,067 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 50,699,974 - 50,729,298 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 51,464,730 - 51,493,994 (-) NCBI UU_Cfam_GSD_1.0
Cntfr Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 166,088,587 - 166,127,184 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 2,636,166 - 2,674,192 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 2,636,166 - 2,674,488 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNTFR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 32,211,777 - 32,251,503 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 32,211,809 - 32,251,412 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 36,352,329 - 36,392,542 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CNTFR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 46,017,992 - 46,068,187 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 46,030,203 - 46,069,944 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 43,135,677 - 43,185,259 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cntfr
.
Predicted Target Of
Count of predictions: 958 Count of miRNA genes: 428 Interacting mature miRNAs: 481 Transcripts: ENSMUST00000064443, ENSMUST00000084701, ENSMUST00000102961, ENSMUST00000102962, ENSMUST00000145379, ENSMUST00000151181 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301203 Alcp8_m alcohol preference locus 8 (mouse) Not determined 4 17395160 51395290 Mouse 1301586 Stheal3_m soft tissue heal 3 (mouse) Not determined 4 28658442 62658566 Mouse 10401115 Pgia35_m proteoglycan induced arthritis 35 (mouse) Not determined 4 12562377 46562509 Mouse 39128211 Lwq22_m liver weight QTL 22 (mouse) 4 17892616 88982216 Mouse 1558992 Ses8_m salmonella enteritidis susceptibility 8 (mouse) Not determined 4 8683240 42683429 Mouse 4141302 Ssrq5_m stress response QTL 5 (mouse) Not determined 8683240 42683430 Mouse 4141555 Nbwa2_m NZB and NZW autoimmunity 2 (mouse) Not determined 4 17892515 51892635 Mouse 10412178 Habiir2_m hyperoxic acute lung injury imprinted region 2 (mouse) Not determined 4 39452126 63283678 Mouse 1300574 Im2_m immunoregulatory 2 (mouse) Not determined 4 28077682 62077816 Mouse 12880405 Jcdq1_m joint cartilage degeneration QTL 1 (mouse) 4 12562377 46562509 Mouse 4142318 Lyr2_m lymphoma resistance 2 (mouse) Not determined 14010457 63283678 Mouse 1301697 Sluc18_m susceptibility to lung cancer 18 (mouse) Not determined 4 22373448 56373612 Mouse 1357453 Kidq4_m kidney weight QTL 4 (mouse) Not determined 4 17892616 88982216 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 1357877 Synch1_m synechia 1 (mouse) Not determined 4 28709925 62710107 Mouse 1300977 Mopkd1_m modifier of polycystic kidney disease progression 1 (mouse) Not determined 4 36550839 70550967 Mouse 25440481 Moaq1_m modifier of alien QTL 1 (mouse) 4 19500000 46000000 Mouse 1301237 Alcp7_m alcohol preference locus 7 (mouse) Not determined 4 17395160 51395290 Mouse 4141911 W6q15_m weight 6 weeks QTL 15 (mouse) Not determined 17892616 88982216 Mouse 1302075 Bdln6_m body length 6 (mouse) Not determined 4 22373448 56373612 Mouse 1302010 Wta1_m weight adult 1 (mouse) Not determined 4 8683240 42683429 Mouse 4142290 Ssrq9_m stress response QTL 9 (mouse) Not determined 34395160 46332776 Mouse 1301437 Scon1_m sucrose consumption 1 (mouse) Not determined 4 22373448 56373612 Mouse 10401905 Sicd3_m seizure-induced cell death 3 (mouse) Not determined 4 9395525 43760862 Mouse 1301473 Triglq1_m triglyceride QTL 1 (mouse) Not determined 4 8683240 42683429 Mouse 1300769 Pcyts2_m plasmacytoma susceptibility 2 (mouse) Not determined 4 22111944 56112145 Mouse 1301792 Hdlq10_m HDL QTL 10 (mouse) Not determined 4 35859707 69859853 Mouse 1301990 Arvm1_m autoimmune renal vasculitis 1 (mouse) Not determined 4 29332646 63332776 Mouse 1302116 Bbaa1_m B.burgdorferi-associated arthritis 1 (mouse) Not determined 4 38250930 72251078 Mouse 1302058 Hrtfm3_m heart failure modifier 3 (mouse) Not determined 4 22111944 56112145 Mouse 1302184 Aaom1_m autoimmune aoritis in MRL mice 1 (mouse) Not determined 4 24322299 46332776 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 1302125 Lxw1_m lupus BXSB x NZW 1 (mouse) Not determined 4 8683240 42683429 Mouse
AW553376
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 66,491,600 - 66,491,698 UniSTS GRCm38 GRCm38 4 41,758,184 - 41,758,546 UniSTS GRCm38 MGSCv37 4 41,705,057 - 41,705,419 UniSTS GRCm37 MGSCv37 18 66,651,254 - 66,651,352 UniSTS GRCm37 Celera 18 67,778,123 - 67,778,221 UniSTS Celera 4 41,418,966 - 41,419,328 UniSTS Cytogenetic Map 18 E1 UniSTS Cytogenetic Map 4 A5 UniSTS cM Map 4 19.9 UniSTS cM Map 4 19.9 UniSTS Whitehead/MRC_RH 18 840.95 UniSTS
AW987258
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 41,712,066 - 41,712,172 UniSTS GRCm38 MGSCv37 4 41,659,098 - 41,659,204 UniSTS GRCm37 Celera 4 41,372,278 - 41,372,384 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 4 A5 UniSTS cM Map 4 19.9 UniSTS Whitehead/MRC_RH 4 661.04 UniSTS
Cntfr
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 41,663,207 - 41,663,572 UniSTS GRCm38 MGSCv37 4 41,610,238 - 41,610,603 UniSTS GRCm37 Celera 4 41,325,696 - 41,326,061 UniSTS Cytogenetic Map 4 A5 UniSTS cM Map 4 19.9 UniSTS
D17Mit264
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 41,745,683 - 41,745,802 UniSTS GRCm38 MGSCv37 4 41,692,556 - 41,692,675 UniSTS GRCm37 Celera 4 41,406,460 - 41,406,579 UniSTS Cytogenetic Map 4 A5 UniSTS cM Map 17 22.5 UniSTS cM Map 4 UniSTS Whitehead Genetic 17 12.0 UniSTS
AF004927
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 41,738,845 - 41,738,933 UniSTS GRCm38 MGSCv37 4 41,685,718 - 41,685,806 UniSTS GRCm37 Celera 4 41,399,627 - 41,399,715 UniSTS Cytogenetic Map 4 A5-B2 UniSTS Cytogenetic Map 4 A5 UniSTS cM Map 4 19.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000064443
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,669,674 - 41,695,445 (-) Ensembl GRCm38.p6 Ensembl 4 41,669,674 - 41,695,445 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000084701
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,669,674 - 41,697,089 (-) Ensembl GRCm38.p6 Ensembl 4 41,669,674 - 41,697,089 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000102961 ⟹ ENSMUSP00000100026
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,657,498 - 41,695,442 (-) Ensembl GRCm38.p6 Ensembl 4 41,657,498 - 41,695,442 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000102962 ⟹ ENSMUSP00000100027
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,657,498 - 41,697,040 (-) Ensembl GRCm38.p6 Ensembl 4 41,657,498 - 41,697,040 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000145379 ⟹ ENSMUSP00000115631
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,670,982 - 41,695,935 (-) Ensembl GRCm38.p6 Ensembl 4 41,670,982 - 41,695,935 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000151181
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 41,663,268 - 41,664,034 (-) Ensembl GRCm38.p6 Ensembl 4 41,663,268 - 41,664,034 (-) Ensembl
RefSeq Acc Id:
NM_001136056 ⟹ NP_001129528
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,476 (-) NCBI GRCm38 4 41,657,498 - 41,695,453 (-) NCBI MGSCv37 4 41,604,529 - 41,644,123 (-) RGD Celera 4 41,319,986 - 41,355,439 (-) RGD cM Map 4 ENTREZGENE
Sequence:
CAGTGGAGGCGGCGGCTCCAGCCGGCGCGGCGCGGGGTTCGGCAGTGGGATCCGGCCGCAGTGCTCGCTCCGCGCTCCTGCCTCGCTCCCCGCCTGCAGCGGCCGAAGGGCGCGGCGCGGAGCCCGGG
hide sequence
RefSeq Acc Id:
NM_001379211 ⟹ NP_001366140
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,475 (-) NCBI GRCm38 4 41,657,500 - 41,695,475 (-) NCBI
Sequence:
GCAGAGCGGGCGGCGGCGGCGGCAGTGGAGGCGGCGGCTCCAGCCGGCGCGGCGCGGGGTTCGGCAGTGGGATCCGGCCGCAGTGCTCGCTCCGCGCTCCTGCCTCGCTCCCCGCCTGCAGCGGCCGA
hide sequence
RefSeq Acc Id:
NM_001379212 ⟹ NP_001366141
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,925 (-) NCBI GRCm38 4 41,657,500 - 41,695,925 (-) NCBI
Sequence:
CGCGTTTGCAAGACCCGCGGCCCGAGCGCGCGTGAAGCACGGGGTCCATAGCCGTCCAGAGGGC
hide sequence
RefSeq Acc Id:
NM_001379213 ⟹ NP_001366142
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,720 (-) NCBI GRCm38 4 41,657,500 - 41,695,720 (-) NCBI
Sequence:
CGTGCCGCGCGTGCCAGGCGCGGGAACGTGCCAAAGCGGAGGCGCGCGGGGGCCGTGGCGGGGA
hide sequence
RefSeq Acc Id:
NM_001379214 ⟹ NP_001366143
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,475 (-) NCBI GRCm38 4 41,657,500 - 41,695,475 (-) NCBI
Sequence:
GCAGAGCGGGCGGCGGCGGCGGCAGTGGAGGCGGCGGCTCCAGCCGGCGCGGCGCGGGGTTCGGCAGTGGGATCCGGCCGCAGTGCTCGCTCCGCGCTCCTGCCTCGCTCCCCGCCTGCAGCGGCCGA
hide sequence
RefSeq Acc Id:
NM_001379215 ⟹ NP_001366144
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,696,037 (-) NCBI GRCm38 4 41,657,500 - 41,696,037 (-) NCBI
Sequence:
TGTGTGCAGGAGAGACCTGGCCAAAGCTGAGAGTGTGATGAGCGATCACTCGCGGAACCCTGCC
hide sequence
RefSeq Acc Id:
NM_001379216 ⟹ NP_001366145
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,689,180 (-) NCBI GRCm38 4 41,657,500 - 41,689,180 (-) NCBI
Sequence:
GGAGCAGCTGTAATTACAGGGCATTTATTATTAATCAGATGAGATTGTTGGAAGCAGCTGGTGT
hide sequence
RefSeq Acc Id:
NM_001403746 ⟹ NP_001390675
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,695,476 (-) NCBI
RefSeq Acc Id:
NM_001403747 ⟹ NP_001390676
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,684,006 (-) NCBI
RefSeq Acc Id:
NM_016673 ⟹ NP_057882
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,500 - 41,697,091 (-) NCBI GRCm38 4 41,657,498 - 41,697,091 (-) ENTREZGENE MGSCv37 4 41,604,529 - 41,644,123 (-) RGD Celera 4 41,319,986 - 41,355,439 (-) RGD cM Map 4 ENTREZGENE
Sequence:
GCGCGCGTGCCCGCGCCTGCGTGTGTTCCCATCACCAACGCTCCGTATTTCGTCGCCCTTCCTG
hide sequence
RefSeq Acc Id:
XM_030253151 ⟹ XP_030109011
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 41,657,498 - 41,695,319 (-) NCBI GRCm38 4 41,657,498 - 41,695,319 (-) NCBI
Sequence:
GAGGGCGCGGTGAGTGTTCCGCGGCGGTCTGCGCGAGGCTTGACCCTCGAACGCTCAAGGCGGA
hide sequence
RefSeq Acc Id:
NP_057882 ⟸ NM_016673
- Peptide Label:
preproprotein
- UniProtKB:
Q80T01 (UniProtKB/Swiss-Prot), O88507 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
- Sequence:
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCS
hide sequence
RefSeq Acc Id:
NP_001129528 ⟸ NM_001136056
- Peptide Label:
preproprotein
- UniProtKB:
Q80T01 (UniProtKB/Swiss-Prot), O88507 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
- Sequence:
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCS
hide sequence
RefSeq Acc Id:
XP_030109011 ⟸ XM_030253151
- Peptide Label:
isoform X2
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366144 ⟸ NM_001379215
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366141 ⟸ NM_001379212
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366142 ⟸ NM_001379213
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366140 ⟸ NM_001379211
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366143 ⟸ NM_001379214
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001366145 ⟸ NM_001379216
- Peptide Label:
preproprotein
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000115631 ⟸ ENSMUST00000145379
Ensembl Acc Id:
ENSMUSP00000100027 ⟸ ENSMUST00000102962
Ensembl Acc Id:
ENSMUSP00000100026 ⟸ ENSMUST00000102961
RefSeq Acc Id:
NP_001390675 ⟸ NM_001403746
- Peptide Label:
precursor
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390676 ⟸ NM_001403747
- Peptide Label:
precursor
- UniProtKB:
O88507 (UniProtKB/Swiss-Prot), Q80T01 (UniProtKB/Swiss-Prot), C9K0Z6 (UniProtKB/TrEMBL), Q3UVR2 (UniProtKB/TrEMBL)
RGD ID: 6835073 Promoter ID: MM_KWN:37174 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Liver, Lung Transcripts: OTTMUST00000015295 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 41,611,441 - 41,611,942 (-) MPROMDB
RGD ID: 6849150 Promoter ID: MM_XEF:4911 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Spleen Transcripts: NM_205028 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 41,617,659 - 41,618,159 (-) MPROMDB
RGD ID: 6883114 Promoter ID: EPDNEW_M5008 Type: multiple initiation site Name: Cntfr_2 Description: Mus musculus ciliary neurotrophic factor receptor , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5009 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 41,677,556 - 41,677,616 EPDNEW
RGD ID: 6883116 Promoter ID: EPDNEW_M5009 Type: multiple initiation site Name: Cntfr_1 Description: Mus musculus ciliary neurotrophic factor receptor , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5008 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 41,695,475 - 41,695,535 EPDNEW
