Symbol:
Oma1
Name:
OMA1 zinc metallopeptidase
RGD ID:
1550363
MGI Page
MGI
Description:
Enables metalloendopeptidase activity. Involved in several processes, including diet induced thermogenesis; negative regulation of mitochondrial fusion; and protein processing. Acts upstream of or within cristae formation. Located in mitochondrial inner membrane. Is expressed in alimentary system; cerebral cortex; liver lobe; nose; and submandibular gland primordium. Orthologous to human OMA1 (OMA1 zinc metallopeptidase).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2010001O09Rik; metalloendopeptidase OMA1, mitochondrial; MPRP-1; OMA1 homolog, zinc metallopeptidase; overlapping with the m-AAA protease 1 homolog; ZMPOMA1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OMA1 (OMA1 zinc metallopeptidase) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Oma1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Oma1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OMA1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OMA1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Oma1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OMA1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OMA1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Oma1 (OMA1 zinc metallopeptidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Oma1 (OMA1 zinc metallopeptidase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OMA1 (OMA1 zinc metallopeptidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
OMA1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
oma1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 103,170,991 - 103,229,066 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 103,171,009 - 103,229,065 (+) Ensembl GRCm39 Ensembl GRCm38 4 103,311,875 - 103,371,869 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 103,313,812 - 103,371,868 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 102,986,451 - 103,039,033 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 102,811,778 - 102,864,360 (+) NCBI MGSCv36 mm8 Celera 4 101,671,650 - 101,724,301 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 47.6 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Oma1 Mouse (+)-schisandrin B multiple interactions ISO RGD:1304821 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of OMA1 mRNA] CTD PMID:31150632 Oma1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of OMA1 mRNA CTD PMID:22206623 Oma1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1349527 6480464 Tetrachlorodibenzodioxin results in decreased expression of OMA1 mRNA CTD PMID:11489354 Oma1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1304821 6480464 Tetrachlorodibenzodioxin results in increased expression of OMA1 mRNA CTD PMID:33387578 Oma1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of OMA1 mRNA CTD PMID:21570461 Oma1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of OMA1 mRNA CTD PMID:39298647 Oma1 Mouse 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid increases expression ISO RGD:1349527 6480464 Am 580 results in increased expression of OMA1 mRNA CTD PMID:16982809 Oma1 Mouse 5-aza-2'-deoxycytidine affects expression ISO RGD:1349527 6480464 Decitabine affects the expression of OMA1 mRNA CTD PMID:23300844 Oma1 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1304821 6480464 Propylthiouracil results in decreased expression of OMA1 mRNA CTD PMID:24780913 Oma1 Mouse acetamide increases expression ISO RGD:1304821 6480464 acetamide results in increased expression of OMA1 mRNA CTD PMID:31881176 Oma1 Mouse aristolochic acid A decreases expression ISO RGD:1349527 6480464 aristolochic acid I results in decreased expression of OMA1 mRNA CTD PMID:33212167 Oma1 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of OMA1 mRNA CTD PMID:24960579 Oma1 Mouse benzo[a]pyrene increases methylation ISO RGD:1349527 6480464 Benzo(a)pyrene results in increased methylation of OMA1 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Oma1 Mouse bisphenol A decreases expression ISO RGD:1304821 6480464 bisphenol A results in decreased expression of OMA1 mRNA CTD PMID:25181051 Oma1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of OMA1 mRNA CTD PMID:38685157 Oma1 Mouse cadmium dichloride decreases expression ISO RGD:1349527 6480464 Cadmium Chloride results in decreased expression of OMA1 mRNA CTD PMID:38568856 Oma1 Mouse carbamazepine affects expression ISO RGD:1349527 6480464 Carbamazepine affects the expression of OMA1 mRNA CTD PMID:25979313 Oma1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of OMA1 mRNA CTD PMID:25620056 Oma1 Mouse CGP 52608 multiple interactions ISO RGD:1349527 6480464 CGP 52608 promotes the reaction [RORA protein binds to OMA1 gene] CTD PMID:28238834 Oma1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of OMA1 mRNA CTD PMID:37019170 Oma1 Mouse cisplatin affects expression ISO RGD:1349527 6480464 Cisplatin affects the expression of OMA1 mRNA CTD PMID:23300844 Oma1 Mouse cisplatin multiple interactions ISO RGD:1349527 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of OMA1 mRNA CTD PMID:27392435 Oma1 Mouse copper(II) sulfate decreases expression ISO RGD:1349527 6480464 Copper Sulfate results in decreased expression of OMA1 mRNA CTD PMID:19549813 Oma1 Mouse Cuprizon increases expression ISO RGD:1304821 6480464 Cuprizone results in increased expression of OMA1 mRNA CTD PMID:26577399 Oma1 Mouse cyclosporin A decreases expression ISO RGD:1349527 6480464 Cyclosporine results in decreased expression of OMA1 mRNA CTD PMID:20106945 Oma1 Mouse Dibutyl phosphate affects expression ISO RGD:1349527 6480464 di-n-butylphosphoric acid affects the expression of OMA1 mRNA CTD PMID:37042841 Oma1 Mouse dibutyl phthalate decreases expression ISO RGD:1304821 6480464 Dibutyl Phthalate results in decreased expression of OMA1 mRNA CTD PMID:21266533 Oma1 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of OMA1 mRNA CTD PMID:17361019|PMID:21266533 Oma1 Mouse dicrotophos decreases expression ISO RGD:1349527 6480464 dicrotophos results in decreased expression of OMA1 mRNA CTD PMID:28302478 Oma1 Mouse dorsomorphin multiple interactions ISO RGD:1349527 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Oma1 Mouse emodin multiple interactions ISO RGD:1304821 6480464 Emodin inhibits the reaction [Hydrogen Peroxide results in increased expression of OMA1 protein]; Emodin inhibits more ... CTD PMID:34971761 Oma1 Mouse entinostat increases expression ISO RGD:1349527 6480464 entinostat results in increased expression of OMA1 mRNA CTD PMID:26272509 Oma1 Mouse entinostat multiple interactions ISO RGD:1349527 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Oma1 Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of OMA1 mRNA CTD PMID:35436446 Oma1 Mouse ethanol multiple interactions ISO RGD:1304821 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of OMA1 mRNA CTD PMID:17347304 Oma1 Mouse fenthion increases expression EXP 6480464 Fenthion results in increased expression of OMA1 mRNA CTD PMID:34813904 Oma1 Mouse fluoranthene multiple interactions EXP 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of OMA1 mRNA CTD PMID:28329830 Oma1 Mouse formaldehyde decreases expression ISO RGD:1349527 6480464 Formaldehyde results in decreased expression of OMA1 mRNA CTD PMID:23649840 Oma1 Mouse gentamycin decreases expression ISO RGD:1304821 6480464 Gentamicins results in decreased expression of OMA1 mRNA CTD PMID:33387578 Oma1 Mouse hydrogen peroxide increases expression ISO RGD:1304821 6480464 Hydrogen Peroxide results in increased expression of OMA1 protein CTD PMID:34971761 Oma1 Mouse hydrogen peroxide multiple interactions ISO RGD:1304821 6480464 Emodin inhibits the reaction [Hydrogen Peroxide results in increased expression of OMA1 protein] CTD PMID:34971761 Oma1 Mouse linsidomine increases oxidation ISO RGD:1304821 6480464 linsidomine results in increased oxidation of OMA1 protein CTD PMID:28086193 Oma1 Mouse methamphetamine decreases expression ISO RGD:1304821 6480464 Methamphetamine results in decreased expression of OMA1 mRNA CTD PMID:19564919 Oma1 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of OMA1 mRNA CTD PMID:34813904 Oma1 Mouse methoxychlor affects methylation ISO RGD:1304821 6480464 Methoxychlor affects the methylation of OMA1 gene CTD PMID:35440735 Oma1 Mouse methyl methanesulfonate decreases expression ISO RGD:1349527 6480464 Methyl Methanesulfonate results in decreased expression of OMA1 mRNA CTD PMID:23649840 Oma1 Mouse methylmercury chloride decreases expression ISO RGD:1349527 6480464 methylmercuric chloride results in decreased expression of OMA1 mRNA CTD PMID:28001369 Oma1 Mouse okadaic acid decreases expression ISO RGD:1349527 6480464 Okadaic Acid results in decreased expression of OMA1 mRNA CTD PMID:38832940 Oma1 Mouse oxidopamine multiple interactions ISO RGD:1304821 6480464 Emodin inhibits the reaction [Oxidopamine results in increased expression of OMA1 protein] CTD PMID:34971761 Oma1 Mouse oxidopamine increases expression ISO RGD:1304821 6480464 Oxidopamine results in increased expression of OMA1 protein CTD PMID:34971761 Oma1 Mouse paracetamol decreases expression ISO RGD:1349527 6480464 Acetaminophen results in decreased expression of OMA1 mRNA CTD PMID:21420995|PMID:29067470 Oma1 Mouse paracetamol increases expression ISO RGD:1304821 6480464 Acetaminophen results in increased expression of OMA1 mRNA CTD PMID:33387578 Oma1 Mouse perfluorooctanoic acid increases expression ISO RGD:1304821 6480464 perfluorooctanoic acid results in increased expression of OMA1 protein CTD PMID:34958885 Oma1 Mouse phenobarbital affects expression ISO RGD:1349527 6480464 Phenobarbital affects the expression of OMA1 mRNA CTD PMID:19159669 Oma1 Mouse pirinixic acid increases expression ISO RGD:1304821 6480464 pirinixic acid results in increased expression of OMA1 mRNA CTD PMID:19162173 Oma1 Mouse quercetin decreases expression ISO RGD:1349527 6480464 Quercetin results in decreased expression of OMA1 mRNA CTD PMID:21632981 Oma1 Mouse quercitrin increases expression ISO RGD:1349527 6480464 quercitrin results in increased expression of OMA1 mRNA CTD PMID:25193878 Oma1 Mouse SB 431542 multiple interactions ISO RGD:1349527 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Oma1 Mouse sodium arsenite decreases expression ISO RGD:1349527 6480464 sodium arsenite results in decreased expression of OMA1 mRNA CTD PMID:38568856 Oma1 Mouse sunitinib increases expression ISO RGD:1349527 6480464 Sunitinib results in increased expression of OMA1 mRNA CTD PMID:31533062 Oma1 Mouse tetrachloromethane decreases expression ISO RGD:1304821 6480464 Carbon Tetrachloride results in decreased expression of OMA1 mRNA CTD PMID:31150632 Oma1 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of OMA1 mRNA CTD PMID:31919559 Oma1 Mouse tetrachloromethane multiple interactions ISO RGD:1304821 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of OMA1 mRNA] CTD PMID:31150632 Oma1 Mouse thiram decreases expression ISO RGD:1349527 6480464 Thiram results in decreased expression of OMA1 mRNA CTD PMID:38568856 Oma1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of OMA1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Oma1 Mouse trichloroethene increases expression ISO RGD:1304821 6480464 Trichloroethylene results in increased expression of OMA1 mRNA CTD PMID:33387578 Oma1 Mouse tris(2-butoxyethyl) phosphate affects expression ISO RGD:1349527 6480464 tris(2-butoxyethyl) phosphate affects the expression of OMA1 mRNA CTD PMID:29024780 Oma1 Mouse valproic acid decreases methylation ISO RGD:1349527 6480464 Valproic Acid results in decreased methylation of OMA1 gene CTD PMID:29154799 Oma1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of OMA1 mRNA CTD PMID:17292431 Oma1 Mouse valproic acid affects expression ISO RGD:1349527 6480464 Valproic Acid affects the expression of OMA1 mRNA CTD PMID:25979313 Oma1 Mouse valproic acid increases expression ISO RGD:1349527 6480464 Valproic Acid results in increased expression of OMA1 mRNA CTD PMID:26272509|PMID:28001369 Oma1 Mouse valproic acid multiple interactions ISO RGD:1349527 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (EXP) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) aristolochic acid A (ISO) arsenite(3-) (EXP) benzo[a]pyrene (ISO) bisphenol A (ISO) bisphenol F (EXP) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) cisplatin (ISO) copper(II) sulfate (ISO) Cuprizon (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dorsomorphin (ISO) emodin (ISO) entinostat (ISO) epoxiconazole (EXP) ethanol (ISO) fenthion (EXP) fluoranthene (EXP) formaldehyde (ISO) gentamycin (ISO) hydrogen peroxide (ISO) linsidomine (ISO) methamphetamine (ISO) methidathion (EXP) methoxychlor (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) okadaic acid (ISO) oxidopamine (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) quercitrin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (EXP,ISO)
Biological Process
cellular response to stress (ISO) cristae formation (IGI) diet induced thermogenesis (IMP) energy homeostasis (IMP) glucose metabolic process (IMP) HRI-mediated signaling (ISO,ISS) integrated stress response signaling (ISO,ISS) lipid metabolic process (IMP) mitochondrial protein processing (IBA,IDA,IMP,ISO,ISS) mitochondrial respiratory chain complex assembly (IMP) mitochondrion organization (IGI) negative regulation of mitochondrial fusion (IMP,ISO) positive regulation of apoptotic process (ISO,ISS) positive regulation of cold-induced thermogenesis (IMP) protein autoprocessing (IDA) protein quality control for misfolded or incompletely synthesized proteins (IBA,IEA,ISO) regulation of cristae formation (ISO,ISS) zymogen activation (IDA)
Oma1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 103,170,991 - 103,229,066 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 103,171,009 - 103,229,065 (+) Ensembl GRCm39 Ensembl GRCm38 4 103,311,875 - 103,371,869 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 103,313,812 - 103,371,868 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 102,986,451 - 103,039,033 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 102,811,778 - 102,864,360 (+) NCBI MGSCv36 mm8 Celera 4 101,671,650 - 101,724,301 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 47.6 NCBI
OMA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 58,480,719 - 58,546,726 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 58,415,384 - 58,546,802 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 58,946,391 - 59,012,398 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 58,718,979 - 58,785,034 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 58,658,412 - 58,724,467 NCBI Celera 1 57,230,483 - 57,296,551 (-) NCBI Celera Cytogenetic Map 1 p32.2-p32.1 NCBI HuRef 1 57,056,927 - 57,123,029 (-) NCBI HuRef CHM1_1 1 59,060,902 - 59,127,809 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 58,358,657 - 58,424,702 (-) NCBI T2T-CHM13v2.0
Oma1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 123,312,038 - 123,455,540 (+) NCBI GRCr8 mRatBN7.2 5 118,083,728 - 118,136,980 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 118,083,728 - 118,136,980 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 120,722,572 - 120,775,362 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 122,447,936 - 122,500,734 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 122,499,218 - 122,552,008 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 122,847,624 - 122,900,475 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 122,847,645 - 122,900,475 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 126,714,757 - 126,767,291 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 124,261,197 - 124,314,715 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 124,271,169 - 124,319,934 (+) NCBI Celera 5 116,654,899 - 116,707,757 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
Oma1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 1,305,802 - 1,393,788 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 1,305,802 - 1,393,190 (+) NCBI ChiLan1.0 ChiLan1.0
OMA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 168,299,110 - 168,562,551 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 167,449,177 - 167,715,879 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 57,549,404 - 57,811,246 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 59,253,869 - 59,516,474 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 59,448,436 - 59,516,170 (-) Ensembl panpan1.1 panPan2
OMA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 51,143,437 - 51,213,913 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 51,134,685 - 51,213,673 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 51,209,451 - 51,281,224 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 51,324,786 - 51,396,658 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 51,324,816 - 51,396,655 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 51,274,280 - 51,345,783 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 51,219,506 - 51,291,067 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 51,503,039 - 51,574,948 (+) NCBI UU_Cfam_GSD_1.0
Oma1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 72,121,433 - 72,183,447 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 3,233,510 - 3,294,798 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 3,232,877 - 3,294,832 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OMA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 153,882,451 - 153,949,468 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 153,882,398 - 153,950,460 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 141,476,698 - 141,544,839 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OMA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 74,435,190 - 74,500,220 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 74,442,696 - 74,499,969 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 42,861,043 - 42,928,149 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Oma1
.
Predicted Target Of
Count of predictions: 267 Count of miRNA genes: 225 Interacting mature miRNAs: 240 Transcripts: ENSMUST00000035780, ENSMUST00000133178, ENSMUST00000143399 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226782 Tibl2_m tibia length 2, 5 week (mouse) 4 90888237 111257197 Mouse 13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 11532708 Sluc43i_m susceptibility to lung cancer 43i (mouse) 4 74444699 108444983 Mouse 11532707 Sluc43h_m susceptibility to lung cancer 43h (mouse) 4 74444699 108444983 Mouse 11532706 Sluc43c_m susceptibility to lung cancer 43c (mouse) 4 74444699 108444983 Mouse 27226770 Tibl11_m tibia length 11, 10 week (mouse) 4 88518237 108357197 Mouse 11532705 Sluc43b_m susceptibility to lung cancer 43b (mouse) 4 74444699 108444983 Mouse 1302044 Nss1_m NOD Sjogren's syndrome 1 (mouse) Not determined 4 71982069 105982216 Mouse 11532704 Sluc43a_m susceptibility to lung cancer 43a (mouse) 4 74444699 108444983 Mouse 14696687 Gdq1_m grooming duration QTL 1, males (mouse) 4 96888237 111857197 Mouse 27226766 Tibl17_m tibia length 17, 16 week (mouse) 4 88518237 108457197 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 27226760 Feml19_m femur length 19, 16 week (mouse) 4 90888237 108457197 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 1302031 Bulb1_m bulb size 1 (mouse) Not determined 4 74033887 108034029 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 12904933 Edlmmq3_m extensor digitorum longus muscle mass QTL 3 (mouse) 4 81213991 115213991 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 27226801 Feml6_m femur length 6, 5 week (mouse) 4 87518237 103257197 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 11532703 Sluc43g_m susceptibility to lung cancer 43g (mouse) 4 74444699 108444983 Mouse 11532702 Sluc43f_m susceptibility to lung cancer 43f (mouse) 4 74444699 108444983 Mouse 11532701 Sluc43e_m susceptibility to lung cancer 43e (mouse) 4 74444699 108444983 Mouse 1558948 Ath8_m atherosclerosis 8 (mouse) Not determined 4 45658442 105156995 Mouse 11532700 Sluc43d_m susceptibility to lung cancer 43d (mouse) 4 74444699 108444983 Mouse 11039517 Ltpr4_m Leishmania tropica response 4 (mouse) 4 79365751 113365867 Mouse 11039504 Ltpr4a_m Leishmania tropica response 4a (mouse) 4 79365751 113365867 Mouse 11039505 Ltpr4c_m Leishmania tropica response 4c (mouse) 4 79365751 113365867 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 1302057 Pgia27_m proteoglycan induced arthritis 27 (mouse) Not determined 4 70067227 104067464 Mouse 1301545 Gauc_m glucose area under curve (mouse) Not determined 4 76763107 110763305 Mouse 11039506 Ltpr4b_m Leishmania tropica response 4b (mouse) 4 79365751 113365867 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 27226787 Feml14_m femur length 14, 10 week (mouse) 4 84918237 107157197 Mouse 10412193 Plep_m plasma lepin levels (mouse) Not determined 4 74444699 108444983 Mouse 27095900 Scvln9_m sacral vertebrae length 2, 10 week (mouse) 4 68018237 107157197 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 1300689 Dob1_m Dietary obesity 1 (mouse) Body weight 4 101574601 123127211 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 26884434 Zlq1_m zygomatic length QTL 1, 5 week (mouse) 4 53700000 103257197 Mouse 26884435 Zlq4_m zygomatic length QTL 4, 10 week (mouse) 4 85118237 104957197 Mouse 1300697 Sle2_m systemic lupus erythmatosus susceptibility 2 (mouse) Not determined 4 77957579 111957775 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 26884431 Zlq8_m zygomatic length QTL 8, 16 week (mouse) 4 74718237 108357197 Mouse 12879897 Berr4_m berghei resistance locus 4 (mouse) 4 71982069 105982216 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 27226746 Metcl8_m metatarsal-calcaneal length 8, 10 week (mouse) 4 87518237 107157197 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 27095927 Pglq7_m pelvic girdle length QTL 7, 10 week (mouse) 4 88118237 108357197 Mouse 27095921 Pglq12_m pelvic girdle length QTL 12, 16 week (mouse) 4 83118237 108357197 Mouse 27226739 Metcl14_m metatarsal-calcaneal length 14, 16 week (mouse) 4 87518237 108357197 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 1300966 Pabr2_m plasma apolipoprotein B (human) regulator 2 (mouse) Not determined 4 46332646 105801860 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 1301739 Pitm2_m prion incubation time 2 (mouse) Not determined 4 71982069 105982216 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27226724 Tibw2_m tibia width 2, proximal, 10 week (mouse) 4 43000000 108357197 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000035780 ⟹ ENSMUSP00000045269
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 103,171,009 - 103,223,640 (+) Ensembl GRCm38.p6 Ensembl 4 103,313,812 - 103,366,443 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133178
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 103,186,105 - 103,229,065 (+) Ensembl GRCm38.p6 Ensembl 4 103,328,908 - 103,371,868 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000143399
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 103,181,681 - 103,186,086 (+) Ensembl GRCm38.p6 Ensembl 4 103,324,484 - 103,328,889 (+) Ensembl
RefSeq Acc Id:
NM_001419114 ⟹ NP_001406043
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419115 ⟹ NP_001406044
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419116 ⟹ NP_001406045
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419117 ⟹ NP_001406046
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419118 ⟹ NP_001406047
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419119 ⟹ NP_001406048
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419120 ⟹ NP_001406049
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,229,066 (+) NCBI
RefSeq Acc Id:
NM_001419121 ⟹ NP_001406050
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419122 ⟹ NP_001406051
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,211,596 (+) NCBI
RefSeq Acc Id:
NM_001419123 ⟹ NP_001406052
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,191,418 (+) NCBI
RefSeq Acc Id:
NM_001419124 ⟹ NP_001406053
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,211,596 (+) NCBI
RefSeq Acc Id:
NM_001419125 ⟹ NP_001406054
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,191,418 (+) NCBI
RefSeq Acc Id:
NM_001419126 ⟹ NP_001406055
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419127 ⟹ NP_001406056
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419128 ⟹ NP_001406057
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419129 ⟹ NP_001406058
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419130 ⟹ NP_001406059
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419131 ⟹ NP_001406060
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI
RefSeq Acc Id:
NM_001419132 ⟹ NP_001406061
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,211,596 (+) NCBI
RefSeq Acc Id:
NM_025909 ⟹ NP_080185
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,040 - 103,223,626 (+) NCBI GRCm38 4 103,313,846 - 103,366,428 (+) NCBI MGSCv37 4 102,986,451 - 103,039,033 (+) RGD Celera 4 101,671,650 - 101,724,301 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GGATTCCGCTCGGGCTGTGGCTTCAGTGCGCGCTCACGATAACCAAGCAAAAGAAAGATGAGCCTCCTTTATGGACTGCAGTCTACCAGGATAAATCGGTTTCTCTCTGGAGTGAATAACCTGGCCAA
hide sequence
RefSeq Acc Id:
XM_006503299 ⟹ XP_006503362
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,674 - 103,223,631 (+) NCBI GRCm38 4 103,314,481 - 103,366,434 (+) NCBI
Sequence:
TTTTTTTTTTTTTTTTTTTTTTTAAGAAGCTGTCCATCATGTGTACTTAGCTGGAATGATTATTTTAAAGTGCATGTCCTATTTTTGCCAATCTGACAGCTGTTTCCATAGAAACTAGAGAAGAAATT
hide sequence
RefSeq Acc Id:
XM_017320360 ⟹ XP_017175849
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,170,991 - 103,229,066 (+) NCBI GRCm38 4 103,313,794 - 103,371,869 (+) NCBI
Sequence:
AGTGAGGGGGCGGGGCTTGGGAAAGGTGTGCGCCTGCGCGGAGCCGGCTGTTGGATTCCGCTCGGGCTGTGGCTTCAGTGCGCGCTCACGATAACCAAGCAAAAGAAAGATGAGCCTCCTTTATGGAC
hide sequence
RefSeq Acc Id:
XM_030253714 ⟹ XP_030109574
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,674 - 103,229,066 (+) NCBI GRCm38 4 103,314,481 - 103,371,869 (+) NCBI
Sequence:
TTTTTTTTTTTTTTTTTTTTTTTAAGAAGCTGTCCATCATGTGTACTTAGCTGGAATGATTATT
hide sequence
RefSeq Acc Id:
XM_036164356 ⟹ XP_036020249
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,045 - 103,229,066 (+) NCBI
Sequence:
ATTCCGCTCGGGCTGTGGCTTCAGTGCGCGCTCACGGTGACGGCTCGGCGTTCTTCCAGAGCGG
hide sequence
RefSeq Acc Id:
XM_036164358 ⟹ XP_036020251
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,171,674 - 103,223,631 (+) NCBI
Sequence:
TTTTTTTTTTTTTTTTTTTTTTTAAGAAGCTGTCCATCATGTGTACTTAGCTGGAATGATTATT
hide sequence
RefSeq Acc Id:
XR_867888
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 103,170,991 - 103,210,784 (+) NCBI GRCm38 4 103,313,794 - 103,353,587 (+) NCBI
Sequence:
AGTGAGGGGGCGGGGCTTGGGAAAGGTGTGCGCCTGCGCGGAGCCGGCTGTTGGATTCCGCTCGGGCTGTGGCTTCAGTGCGCGCTCACGATAACCAAGCAAAAGAAAGATGAGCCTCCTTTATGGAC
hide sequence
RefSeq Acc Id:
NP_080185 ⟸ NM_025909
- Peptide Label:
isoform a precursor
- UniProtKB:
Q3UWN9 (UniProtKB/Swiss-Prot), Q9D8H7 (UniProtKB/Swiss-Prot)
- Sequence:
MSLLYGLQSTRINRFLSGVNNLANRRQWTPPASCPLAPKLRAVNAYWGLNTVSHCHSVTLLPRNFLFCRTLNHKKSRCLSSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIE
hide sequence
RefSeq Acc Id:
XP_006503362 ⟸ XM_006503299
- Peptide Label:
isoform X1
- UniProtKB:
Q3UWN9 (UniProtKB/Swiss-Prot), Q9D8H7 (UniProtKB/Swiss-Prot)
- Sequence:
MSLLYGLQSTRINRFLSGVNNLANRRQWTPPASCPLAPKLRAVNAYWGLNTVSHCHSVTLLPRN
hide sequence
RefSeq Acc Id:
XP_017175849 ⟸ XM_017320360
- Peptide Label:
isoform X4
- Sequence:
MSLLYGLQSTRINRFLSGVNNLANRRQWTPPASCPLAPKLRAVNAYWGLNTVSHCHSVTLLPRNFLFCRTLNHKKSRCLSSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIE
hide sequence
RefSeq Acc Id:
XP_030109574 ⟸ XM_030253714
- Peptide Label:
isoform X8
Ensembl Acc Id:
ENSMUSP00000045269 ⟸ ENSMUST00000035780
RefSeq Acc Id:
XP_036020249 ⟸ XM_036164356
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_036020251 ⟸ XM_036164358
- Peptide Label:
isoform X7
RefSeq Acc Id:
NP_001406049 ⟸ NM_001419120
- Peptide Label:
isoform d precursor
RefSeq Acc Id:
NP_001406050 ⟸ NM_001419121
- Peptide Label:
isoform e precursor
- UniProtKB:
Q9D8H7 (UniProtKB/Swiss-Prot), Q3UWN9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001406058 ⟸ NM_001419129
- Peptide Label:
isoform j
RefSeq Acc Id:
NP_001406045 ⟸ NM_001419116
- Peptide Label:
isoform b precursor
RefSeq Acc Id:
NP_001406044 ⟸ NM_001419115
- Peptide Label:
isoform a precursor
- UniProtKB:
Q9D8H7 (UniProtKB/Swiss-Prot), Q3UWN9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001406046 ⟸ NM_001419117
- Peptide Label:
isoform b precursor
RefSeq Acc Id:
NP_001406057 ⟸ NM_001419128
- Peptide Label:
isoform j
RefSeq Acc Id:
NP_001406048 ⟸ NM_001419119
- Peptide Label:
isoform c precursor
RefSeq Acc Id:
NP_001406047 ⟸ NM_001419118
- Peptide Label:
isoform b precursor
RefSeq Acc Id:
NP_001406056 ⟸ NM_001419127
- Peptide Label:
isoform j
RefSeq Acc Id:
NP_001406060 ⟸ NM_001419131
- Peptide Label:
isoform k
RefSeq Acc Id:
NP_001406055 ⟸ NM_001419126
- Peptide Label:
isoform j
RefSeq Acc Id:
NP_001406059 ⟸ NM_001419130
- Peptide Label:
isoform k
RefSeq Acc Id:
NP_001406043 ⟸ NM_001419114
- Peptide Label:
isoform a precursor
- UniProtKB:
Q9D8H7 (UniProtKB/Swiss-Prot), Q3UWN9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001406051 ⟸ NM_001419122
- Peptide Label:
isoform f precursor
RefSeq Acc Id:
NP_001406053 ⟸ NM_001419124
- Peptide Label:
isoform h precursor
RefSeq Acc Id:
NP_001406061 ⟸ NM_001419132
- Peptide Label:
isoform l
RefSeq Acc Id:
NP_001406052 ⟸ NM_001419123
- Peptide Label:
isoform g precursor
RefSeq Acc Id:
NP_001406054 ⟸ NM_001419125
- Peptide Label:
isoform i precursor
RGD ID: 6835784 Promoter ID: MM_KWN:38725 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000018318 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 102,986,331 - 102,986,831 (+) MPROMDB
RGD ID: 6884062 Promoter ID: EPDNEW_M5461 Type: initiation region Name: Oma1_1 Description: Mus musculus OMA1 zinc metallopeptidase , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 103,313,846 - 103,313,906 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-29
Oma1
OMA1 zinc metallopeptidase
OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
Symbol and/or name change
5135510 APPROVED
