Oma1 (OMA1 zinc metallopeptidase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Oma1 (OMA1 zinc metallopeptidase) Rattus norvegicus

Analyze

Symbol:

Oma1

Name:

OMA1 zinc metallopeptidase

RGD ID:

1304821

Description:

Predicted to enable metalloendopeptidase activity. Predicted to be involved in several processes, including HRI-mediated signaling; proteolysis; and regulation of mitochondrion organization. Predicted to act upstream of or within cristae formation. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrial intermembrane space. Orthologous to human OMA1 (OMA1 zinc metallopeptidase); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC298282; metalloendopeptidase OMA1, mitochondrial; OMA1 homolog, zinc metallopeptidase; OMA1 homolog, zinc metallopeptidase (S. cerevisiae); overlapping with the m-AAA protease 1 homolog; RGD1304821; similar to RIKEN cDNA 2010001O09; zinc metallopeptidase homolog; zinc metallopeptidase homolog (S. cerevisiae)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OMA1 (OMA1 zinc metallopeptidase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Oma1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Oma1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OMA1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OMA1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Oma1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OMA1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OMA1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Oma1 (OMA1 zinc metallopeptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OMA1 (OMA1 zinc metallopeptidase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Oma1 (OMA1 zinc metallopeptidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OMA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	oma1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: suggests misassembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	118,083,728 - 118,136,980 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	118,083,728 - 118,136,980 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	120,722,572 - 120,775,362 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	122,447,936 - 122,500,734 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	122,499,218 - 122,552,008 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	122,847,624 - 122,900,475 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	122,847,645 - 122,900,475 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	126,714,757 - 126,767,291 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	124,261,197 - 124,314,715 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	124,271,169 - 124,319,934 (+)	NCBI
Celera	5	116,654,899 - 116,707,757 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

emodin (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (EXP)

fenthion (ISO)

fluoranthene (ISO)

formaldehyde (ISO)

gentamycin (EXP)

hydrogen peroxide (EXP)

linsidomine (EXP)

methamphetamine (EXP)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

oxidopamine (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (EXP)

quercetin (ISO)

quercitrin (ISO)

SB 431542 (ISO)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cristae formation (IEA,ISO)

diet induced thermogenesis (IEA,ISO,ISS)

energy homeostasis (ISO,ISS)

glucose metabolic process (IEA,ISO,ISS)

HRI-mediated signaling (ISO,ISS)

integrated stress response signaling (ISO,ISS)

lipid metabolic process (IEA,ISO,ISS)

mitochondrial protein processing (IBA,IEA,ISO,ISS)

mitochondrial respiratory chain complex assembly (IEA,ISO,ISS)

mitochondrion organization (ISO)

negative regulation of mitochondrial fusion (IEA,ISO,ISS)

positive regulation of apoptotic process (ISO,ISS)

positive regulation of cold-induced thermogenesis (IEA,ISO,ISS)

protein autoprocessing (IEA,ISO,ISS)

protein quality control for misfolded or incompletely synthesized proteins (IBA,ISO,ISS)

proteolysis (IEA)

regulation of cristae formation (ISO,ISS)

zymogen activation (IEA,ISO,ISS)

Cellular Component

membrane (IEA)

mitochondrial inner membrane (IBA,IEA,ISO,ISS)

mitochondrial intermembrane space (ISO)

mitochondrial membrane (ISO,ISS)

mitochondrion (ISO)

Molecular Function

lipid binding (IEA)

metal ion binding (IEA)

metalloendopeptidase activity (IBA,IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Loss of mitochondrial protease OMA1 alters processing of the GTPase OPA1 and causes obesity and defective thermogenesis in mice.	Quirós PM, etal., EMBO J. 2012 May 2;31(9):2117-33. doi: 10.1038/emboj.2012.70. Epub 2012 Mar 20.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:20038677	PMID:20038678	PMID:25605331	PMID:33383158

Genomics

Comparative Map Data

Oma1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	118,083,728 - 118,136,980 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	118,083,728 - 118,136,980 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	120,722,572 - 120,775,362 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	122,447,936 - 122,500,734 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	122,499,218 - 122,552,008 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	122,847,624 - 122,900,475 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	122,847,645 - 122,900,475 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	126,714,757 - 126,767,291 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	124,261,197 - 124,314,715 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	124,271,169 - 124,319,934 (+)	NCBI
Celera	5	116,654,899 - 116,707,757 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

OMA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	58,480,719 - 58,546,726 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	58,415,384 - 58,546,802 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	58,946,391 - 59,012,398 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	58,718,979 - 58,785,034 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	58,658,412 - 58,724,467	NCBI
Celera	1	57,230,483 - 57,296,551 (-)	NCBI		Celera
Cytogenetic Map	1	p32.2-p32.1	NCBI
HuRef	1	57,056,927 - 57,123,029 (-)	NCBI		HuRef
CHM1_1	1	59,060,902 - 59,127,809 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	58,358,657 - 58,424,702 (-)	NCBI		T2T-CHM13v2.0

Oma1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	103,170,991 - 103,229,066 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	103,171,009 - 103,229,065 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	103,311,875 - 103,371,869 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	103,313,812 - 103,371,868 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	102,986,451 - 103,039,033 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	102,811,778 - 102,864,360 (+)	NCBI		MGSCv36	mm8
Celera	4	101,671,650 - 101,724,301 (+)	NCBI		Celera
Cytogenetic Map	4	C6	NCBI
cM Map	4	47.6	NCBI

Oma1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	1,305,802 - 1,393,788 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955464	1,305,802 - 1,393,190 (+)	NCBI	ChiLan1.0	ChiLan1.0

OMA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	167,449,177 - 167,715,879 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	57,549,404 - 57,811,246 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	59,253,869 - 59,516,474 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	59,448,436 - 59,516,170 (-)	Ensembl	panpan1.1		panPan2

OMA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	51,143,437 - 51,213,913 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	51,134,685 - 51,213,673 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	51,209,451 - 51,281,224 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	51,324,786 - 51,396,658 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	51,324,816 - 51,396,655 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	51,274,280 - 51,345,783 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	51,219,506 - 51,291,067 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	51,503,039 - 51,574,948 (+)	NCBI		UU_Cfam_GSD_1.0

Oma1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	72,121,433 - 72,183,447 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	3,233,510 - 3,294,798 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	3,232,877 - 3,294,832 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OMA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	153,882,451 - 153,949,468 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	153,882,398 - 153,950,460 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	141,476,698 - 141,544,839 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OMA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	74,435,190 - 74,500,220 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	74,442,696 - 74,499,969 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	42,861,043 - 42,928,149 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Oma1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624862	1,745,400 - 1,824,005 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624862	1,745,188 - 1,823,261 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Oma1
376 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	75
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000009516
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1582212	Livw2	Liver weight QTL 2	3.5	0.0004	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	5	99016066	119085810	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
7794739	Bp372	Blood pressure QTL 372		0.0058	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	117913688	125222967	Rat

Markers in Region

RH134945

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	118,136,744 - 118,136,951 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	122,900,239 - 122,900,446	NCBI	Rnor6.0
Rnor_5.0	5	126,767,055 - 126,767,262	UniSTS	Rnor5.0
RGSC_v3.4	5	124,314,479 - 124,314,686	UniSTS	RGSC3.4
Celera	5	116,707,521 - 116,707,728	UniSTS
Cytogenetic Map	5	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	13	29	22	17	22	7	10	6	29	17	2	7
Low		30	28	19	2	19	1	1	68	6	22	9	1
Below cutoff											2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000009516 ⟹ ENSRNOP00000009515

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	118,083,728 - 118,136,980 (+)	Ensembl
Rnor_6.0 Ensembl	5	122,847,645 - 122,900,475 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106392 ⟹ ENSRNOP00000081972

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	118,083,728 - 118,136,980 (+)	Ensembl

RefSeq Acc Id:

NM_001106669 ⟹ NP_001100139

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	118,083,728 - 118,136,980 (+)	NCBI
Rnor_6.0	5	122,847,645 - 122,900,475 (+)	NCBI
Rnor_5.0	5	126,714,757 - 126,767,291 (+)	NCBI
RGSC_v3.4	5	124,261,197 - 124,314,715 (+)	RGD
Celera	5	116,654,899 - 116,707,757 (+)	RGD

Sequence:

show sequence

GCCTGCGCGGAGCCAGCAGCTGGATCCGGCTCCGGCTGCGGCTCGAGTGCGCGCTCACGATAAC
CAAGCAGAGGTAAGATGAACTTCCTTTATGGACTGCAGTCTGCCACAAGAAATCAGTTTCTCTC
TGGAGTGAATACGCTGGCCCGCAGGAGAACGTGGACCCCACCAGCAGGCTGTCCACTGGCATCG
AGGCTCCCAGCAGTAAATGCAAACTGGGGACTTAGCACAGTCAGTCACTGTTATTCAGTGATCT
TACTGCCCAGAAACCTTCATTTCTGTAGGACTCTCAAGAACAAAAGATCAAGATGCCTCTCAAG
TGCCCAAAGCAAGGAAATGGGGGTGCTCACCTACAATTGGACGGTTTGGGGTGATGCCTCATGT
TCTCCGAACTATGCCGCCATAAGAGAGGTCCGGAGTTTCCACACATCTGCGCCACGTCAGGCCG
CTCCAGTCCCTCTCTTGATGCTCATTCTGAAACCAGTGCAAAAGCTCCTTGCTATCATTGTGGG
CAGGGGCATAAGGAAATGGTGGCAAGCACTTCCCCCTGACAAGAAGGCGCTATTTAAAGACAGC
GTGAAGAGGAACAAGTGGAGGCTGCTCCTTGGTCTGAGTGCCTTTGGACTGCTGTTTGTGGTGT
TTTATTTCACTCACCTGGAAGTGAGCCCTGTCACTGGAAGGAGCAAACTACTGTTAGTGGGGAA
AGAACACTTCAGACTCCTGTCAGACCTGGAATATGAAGTGTGGATGGAAGAGTTTAAAAATGAT
CTGCTGCCTGAGGAAGACCCCCGGTACCTGACTGTCAAGAAGGTGGTTTATCATCTAACACAGT
GCAATCAAGATGTCCCAGGGGTCTCTGAGATCAACTGGGTGGTTCACGTGGTCCATTCGCCCAA
GGTCAATGCCTTCGTGCTTCCAAACGGACAAGTGTTTGTTTTCACTGGGCTTTTGAATAGCGTG
ACCGATATGCACCAGCTTTCCTTCCTCCTGGGCCATGAGATCGCGCATGCGGTCCTGGGGCATG
CCGCAGAAAAGGCTAGCTTGGTTCATTTACTGGATTTCCTTGGCATGATTTTTCTCACAATGAT
TTGGGCCATTTGTCCAAGAGACAGCTTGGCAGTTCTGGGCCAGTGGATACAGTCAAAGTTGCAG
GAGTATATGTTTGATAGACCATACAGTAGAACATTGGAGGCCGAAGCTGACAAAATTGGACTAC
AGCTGGCTGCAAAGGCATGTGTGGACGTAAGAGCTAGTTCAGTGTTTTGGCAGCAGATGGAGTT
CTCAGAGAGCCTTCATGGCTACCCCAAGTTGCCAGAGTGGCTATCAACACATCCTTCTCACGGG
AACCGAGCTGAGTACTTGGACAGACTCATACCACAGGCTCTCAAACTTCGGGAGGTCTGTAATT
GCCCACCACTCTCTGGACCAGACCCTCGGTTACTGTTCAGACTTACTGTGAAACATTTACTTGA
AGACTCCGAGAAAGAGGACCTAAACATCACTGTCAAAAAGCAGAAACCGGATGCTCTGCCCATT
CAGAAGCAGGAGCAGATACCACTGACATACGCACTTGGGAAAAGAACTGCAGGTTGAACTGAAC
CGAATGAATCTTGGGTTCCGTGAGGAGCACAGTGAGCCTTTTCATTCTTATGCAACTCTCAAAA
ACGATGTTTTCAAGGAAAAAAATGGATGTTCAAAGATCAAATCATGTATATTACAGATAATATC
CGGATTTTTCTAGATTTTTATCTTTCATGAAATATTGATGTGTTTTAATCTACTTTAAAATACT
GCCAACGAGGACAATGTCACAGAATAAATCGATGTTACGCATTTCAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100139	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZS74	(Get FASTA)	NCBI Sequence Viewer
	EDL97870	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009515
	ENSRNOP00000009515.4
	ENSRNOP00000081972.1

RefSeq Acc Id:

NP_001100139 ⟸ NM_001106669

- UniProtKB:

D3ZS74 (UniProtKB/Swiss-Prot), A0A8L2Q3X0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNFLYGLQSATRNQFLSGVNTLARRRTWTPPAGCPLASRLPAVNANWGLSTVSHCYSVILLPRN
LHFCRTLKNKRSRCLSSAQSKEMGVLTYNWTVWGDASCSPNYAAIREVRSFHTSAPRQAAPVPL
LMLILKPVQKLLAIIVGRGIRKWWQALPPDKKALFKDSVKRNKWRLLLGLSAFGLLFVVFYFTH
LEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPEEDPRYLTVKKVVYHLTQCNQDV
PGVSEINWVVHVVHSPKVNAFVLPNGQVFVFTGLLNSVTDMHQLSFLLGHEIAHAVLGHAAEKA
SLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKIGLQLAAK
ACVDVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREVCNCPPLS
GPDPRLLFRLTVKHLLEDSEKEDLNITVKKQKPDALPIQKQEQIPLTYALGKRTAG

hide sequence

RefSeq Acc Id:

ENSRNOP00000009515 ⟸ ENSRNOT00000009516

RefSeq Acc Id:

ENSRNOP00000081972 ⟸ ENSRNOT00000106392

Protein Domains

Peptidase M48

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZS74-F1-model_v2	AlphaFold	D3ZS74	1-504	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693868

Promoter ID:

EPDNEW_R4393

Type:

single initiation site

Name:

Oma1_1

Description:

OMA1 zinc metallopeptidase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	122,847,666 - 122,847,726	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304821	AgrOrtholog
BioCyc Gene	G2FUF-40505	BioCyc
Ensembl Genes	ENSRNOG00000007214	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009516	ENTREZGENE
	ENSRNOT00000009516.5	UniProtKB/TrEMBL
	ENSRNOT00000106392.1	UniProtKB/TrEMBL
Gene3D-CATH	Metalloproteases ('zincins'), catalytic domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Peptidase_M48	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:298282	UniProtKB/Swiss-Prot
NCBI Gene	298282	ENTREZGENE
PANTHER	METALLOENDOPEPTIDASE OMA1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	METALLOENDOPEPTIDASE OMA1, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Peptidase_M48	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Oma1	PhenoGen
PROSITE	ZINC_PROTEASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007214	RatGTEx
UniProt	A0A8I5ZTB5_RAT	UniProtKB/TrEMBL
	A0A8L2Q3X0	ENTREZGENE, UniProtKB/TrEMBL
	D3ZS74	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-19	Oma1	OMA1 zinc metallopeptidase	Oma1	zinc metallopeptidase homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Oma1	zinc metallopeptidase homolog (S. cerevisiae)	Oma1	OMA1 homolog, zinc metallopeptidase (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Oma1	OMA1 homolog, zinc metallopeptidase (S. cerevisiae)	Oma1_predicted	OMA1 homolog, zinc metallopeptidase (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Oma1_predicted	OMA1 homolog, zinc metallopeptidase (S. cerevisiae) (predicted)	RGD1304821_predicted	similar to RIKEN cDNA 2010001O09 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1304821_predicted	similar to RIKEN cDNA 2010001O09 (predicted)	LOC298282_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298282_predicted	similar to RIKEN cDNA 2010001O09 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message