Advanced Search (OLGA)

Gene: RAB1A (RAB1A, member RAS oncogene family) Sus scrofa

Subscribe to Updates

Analyze

Symbol:

RAB1A

Name:

RAB1A, member RAS oncogene family

RGD ID:

14187205

Description:

ENCODES a protein that exhibits GTP binding (ortholog); GTPase activity (ortholog); INVOLVED IN autophagosome assembly (ortholog); autophagy (ortholog); cell migration (ortholog); ASSOCIATED WITH dilated cardiomyopathy (ortholog); FOUND IN endoplasmic reticulum membrane (ortholog); exocytic vesicle (ortholog); Golgi membrane (ortholog)

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

RAB1B; RAB1B, member RAS oncogene family; ras-related protein Rab-1A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	76,837,430 - 76,869,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	76,837,673 - 76,868,156 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	80,675,435 - 80,712,268 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RAB1A	Pig	dilated cardiomyopathy		ISO	Rab1a (Mus musculus)	9068941		MouseDO

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RAB1A	Pig	autophagosome assembly	involved_in	IBA	PANTHER:PTN000636233 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	autophagosome assembly	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	autophagosome assembly	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	autophagy	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	autophagy	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	cell migration	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	cell migration	involved_in	IEA	UniProtKB:P62820 more ...	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	cilium assembly	NOT\|involved_in	ISO	RAB1A (Homo sapiens)	9068941	PMID:17646400	UniProt	PMID:17646400
RAB1A	Pig	COPII-coated vesicle cargo loading	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	defense response to bacterium	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	defense response to bacterium	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	endocytosis	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	endocytosis	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	endoplasmic reticulum to Golgi vesicle-mediated transport	acts_upstream_of_or_within	ISO	Rab1a (Rattus norvegicus)	9068941	PMID:15728249	MGI	PMID:15728249 and REF_RGD_ID:8554056
RAB1A	Pig	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	establishment of endothelial intestinal barrier	NOT\|involved_in	ISO	RAB1A (Homo sapiens)	9068941	PMID:23885123	UniProt	PMID:23885123
RAB1A	Pig	Golgi organization	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	Golgi organization	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	growth hormone secretion	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	growth hormone secretion	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	intracellular protein transport	involved_in	IBA	CGD:CAL0000181874 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	melanosome transport	involved_in	IEA	UniProtKB:P62821 and ensembl:ENSMUSP00000127330	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	positive regulation of glycoprotein metabolic process	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	positive regulation of interleukin-8 production	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	positive regulation of interleukin-8 production	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	substrate adhesion-dependent cell spreading	involved_in	IEA	UniProtKB:P62821 and ensembl:ENSMUSP00000127330	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	vesicle transport along microtubule	involved_in	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	vesicle transport along microtubule	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	vesicle-mediated transport	involved_in	IEA	UniProtKB-KW:KW-0931	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	vesicle-mediated transport	involved_in	IBA	FB:FBgn0025382 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	virion assembly	involved_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RAB1A	Pig	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	early endosome	located_in	IEA	UniProtKB-SubCell:SL-0094	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	endomembrane system	is_active_in	IBA	CGD:CAL0000194609 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	endoplasmic reticulum	is_active_in	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	endoplasmic reticulum membrane		ISO	Rab1a (Rattus norvegicus)	9068941		RGD	PMID:8807639 and REF_RGD_ID:2306441
RAB1A	Pig	endosome	located_in	IEA	UniProtKB-KW:KW-0967	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	exocytic vesicle	located_in	ISO	RAB1A (Canis lupus familiaris)	9068941	PMID:18504258	CAFA	PMID:18504258
RAB1A	Pig	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	Golgi apparatus	located_in	IEA	UniProtKB:P62821 and ensembl:ENSMUSP00000127330	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	Golgi membrane		ISO	Rab1a (Rattus norvegicus)	9068941		RGD	PMID:8807639 and REF_RGD_ID:2306441
RAB1A	Pig	melanosome	located_in	IEA	UniProtKB:P62821 and ensembl:ENSMUSP00000127330	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	melanosome	located_in	IEA	UniProtKB-SubCell:SL-0161	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	150520179		UniProt	GO_REF:0000044
RAB1A	Pig	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	neuronal cell body		ISO	Rab1a (Rattus norvegicus)	9068941		RGD	PMID:8573789 and REF_RGD_ID:2306440
RAB1A	Pig	presynapse	is_active_in	ISO	Rab1a (Rattus norvegicus)	9068941	PMID:23622064	SynGO	PMID:23622064 and REF_RGD_ID:13702180
RAB1A	Pig	presynapse	located_in	ISO	Rab1a (Rattus norvegicus)	9068941	PMID:20926670	SynGO-UCL	PMID:20926670 and REF_RGD_ID:13432355
RAB1A	Pig	synapse	is_active_in	ISO	Rab1a (Rattus norvegicus)	9068941	PMID:24876496	SynGO	PMID:24876496 and REF_RGD_ID:10047219

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
RAB1A	Pig	G protein activity	enables	IEA	EC:3.6.5.2	150520179		UniProt	GO_REF:0000003
RAB1A	Pig	GTP binding		ISO	Rab1a (Rattus norvegicus)	9068941		RGD	PMID:8807639 and REF_RGD_ID:2306441
RAB1A	Pig	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	GTP binding	enables	IEA	InterPro:IPR001806 and InterPro:IPR005225	150520179		InterPro	GO_REF:0000002
RAB1A	Pig	GTP binding	enables	IBA	MGI:1861441 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	GTPase activity	enables	IBA	FB:FBgn0015797 more ...	150520179		GO_Central	GO_REF:0000033
RAB1A	Pig	GTPase activity	enables	ISS	UniProtKB:P62820	150520179		UniProt	GO_REF:0000024
RAB1A	Pig	GTPase activity	enables	IEA	UniProtKB:P62820 and ensembl:ENSP00000387286	150520179		Ensembl	GO_REF:0000107
RAB1A	Pig	GTPase activity	enables	IEA	InterPro:IPR001806	150520179		InterPro	GO_REF:0000002
RAB1A	Pig	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	150520179		UniProt	GO_REF:0000043
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P24386	9068941	PMID:7957092	UniProt	PMID:7957092
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q29ST3 and UniProtKB:Q5ZU30	9068941	PMID:30323948	IntAct	PMID:30323948
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P50395 and UniProtKB:Q29ST3	9068941	PMID:20176951	IntAct	PMID:20176951
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P42345 and UniProtKB:Q8N122	9068941	PMID:25446900	IntAct	PMID:25446900
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q96LT7-1 and UniProtKB:Q96LT7-2	9068941	PMID:27334615	IntAct	PMID:27334615
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P31150 and UniProtKB:Q5ZSQ3	9068941	PMID:19942850	IntAct	PMID:19942850
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q96BZ9	9068941	PMID:17684057	UniProt	PMID:17684057
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P47224	9068941	PMID:32296183	IntAct	PMID:32296183
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q6DFW0	9068941	PMID:24549040	UniProt	PMID:24549040
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q8N2Y8	9068941	PMID:15796781	UniProt	PMID:15796781
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q01968	9068941	PMID:16902405 and PMID:25107275	IntAct	PMID:16902405 and PMID:25107275
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:Q6X1Y7	9068941	PMID:17952054	IntAct	PMID:17952054
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P26374	9068941	PMID:15186776	UniProt	PMID:15186776
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P31150 and UniProtKB:P47224	9068941	PMID:33961781	IntAct	PMID:33961781
RAB1A	Pig	protein binding	enables	ISO	UniProtKB:P31150	9068941	PMID:26496610 more ...	IntAct	PMID:26496610 more ...

PMID:14681463	PMID:22301074	PMID:29128753

RAB1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	76,837,430 - 76,869,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	76,837,673 - 76,868,156 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	80,675,435 - 80,712,268 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	65,086,854 - 65,130,106 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	65,070,696 - 65,130,331 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	65,313,988 - 65,357,240 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	65,167,493 - 65,210,793 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	65,225,639 - 65,268,940	NCBI
Celera	2	65,160,375 - 65,204,151 (-)	NCBI		Celera
Cytogenetic Map	2	p14	NCBI
HuRef	2	65,047,966 - 65,091,371 (-)	NCBI		HuRef
CHM1_1	2	65,244,946 - 65,288,425 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	65,096,482 - 65,139,769 (-)	NCBI		T2T-CHM13v2.0

Rab1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	20,151,412 - 20,176,856 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	20,151,432 - 20,176,856 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	20,201,412 - 20,226,856 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	20,201,432 - 20,226,856 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	20,101,605 - 20,126,859 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	20,101,605 - 20,126,859 (+)	NCBI		MGSCv36	mm8
Celera	11	22,350,977 - 22,376,228 (+)	NCBI		Celera
Cytogenetic Map	11	A3.1	NCBI
cM Map	11	12.92	NCBI

Rab1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	98,623,582 - 98,648,766 (+)	NCBI		GRCr8
mRatBN7.2	14	94,422,219 - 94,448,799 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	94,415,275 - 94,448,248 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	98,769,042 - 98,794,089 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	100,009,313 - 100,034,363 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	96,476,690 - 96,501,729 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	104,475,082 - 104,500,176 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	104,475,082 - 104,501,020 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	104,208,420 - 104,235,377 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	100,973,039 - 101,027,893 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	100,992,249 - 101,047,101 (+)	NCBI
Celera	14	93,445,267 - 93,470,406 (+)	NCBI		Celera
Cytogenetic Map	14	q22	NCBI

Rab1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	19,393,589 - 19,421,373 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	19,393,589 - 19,421,373 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAB1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	61,270,062 - 61,312,604 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	61,274,033 - 61,317,572 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	65,149,922 - 65,193,305 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	66,274,809 - 66,318,290 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	66,274,809 - 66,318,290 (-)	Ensembl	panpan1.1		panPan2

RAB1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	64,564,351 - 64,590,654 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	64,564,298 - 64,590,705 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	64,450,720 - 64,476,763 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	65,573,365 - 65,599,500 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	65,571,363 - 65,599,551 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	65,252,173 - 65,278,224 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	65,560,883 - 65,586,917 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	65,854,509 - 65,880,856 (-)	NCBI		UU_Cfam_GSD_1.0

Rab1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	18,679,767 - 18,712,642 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936491	9,858,645 - 9,891,674 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	41,890,055 - 41,932,180 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	69,948,865 - 69,995,044 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	8,420,305 - 8,449,647 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624762	8,420,336 - 8,448,478 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in RAB1A
524 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
10	4	23	3	2	5	14	12	23	3	6	3


RefSeq Transcripts	NM_001031787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AEMK02000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK234779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK395362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK400541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY996813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU694922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU928819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01110367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSSCT00000009153 ⟹ ENSSSCP00000008922

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,474 - 76,869,778 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000031971 ⟹ ENSSSCP00000019583

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,430 - 76,869,027 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000059098 ⟹ ENSSSCP00000053998

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,854,021 - 76,869,774 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000071654 ⟹ ENSSSCP00000068281

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,947 - 76,869,774 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000072082 ⟹ ENSSSCP00000061200

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,474 - 76,868,156 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000074694 ⟹ ENSSSCP00000074229

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,474 - 76,869,778 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000076963 ⟹ ENSSSCP00000059734

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,474 - 76,869,778 (+)	Ensembl

Ensembl Acc Id:

ENSSSCT00000089717 ⟹ ENSSSCP00000059996

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	3	76,837,559 - 76,869,774 (+)	Ensembl

RefSeq Acc Id:

NM_001031787 ⟹ NP_001026957

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	3	76,837,673 - 76,868,156 (+)	NCBI

Sequence:

show sequence

ATGTCCAGCATGAATCCCGAATATGATTATTTATTCAAGTTACTTCTGATTGGCGACTCTGGGGTTGGAAAGTCTTGCCTCCTTCTTAGGTTTGCAGATGATACATATACAGAAAGCTATATCAGCAC
AATTGGTGTGGATTTCAAAATAAGAACTATAGAGTTAGATGGGAAAACAATCAAACTTCAAATATGGGACACAGCAGGCCAAGAAAGATTTCGAACAATCACCTCCAGTTACTACAGAGGAGCCCATG
GCATCATAGTTGTGTATGATGTGACAGATCAGGGGTCCTTCAATAACGTTAAACAGTGGCTACAAGAAATAGATCGTTATGCCAGTGAAAACGTCAACAAGTTGTTGGTAGGGAACAAATGTGATTTG
ACCACAAAGAAAGTAGTAGACTACACAACAGCAAAGGAATTTGCTGATTCCCTTGGAATTCCATTTTTGGAAACCAGTGCTAAGAATGCAACGAATGTAGAACAGTCTTTCATGACGATGGCAGCTGA
GATTAAAAAACGAATGGGTCCTGGAGCAACAGCTGGCGGTGCAGAGAAGTCCAATGTTAAAATTCAGAGCACTCCAGTCAAGCAGTCAGGTGGAGGCTGCTGCTAA

hide sequence


Protein RefSeqs	NP_001026957	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAY17509	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSSCP00000008922
GenBank Protein	Q52NJ2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001026957 ⟸ NM_001031787

- UniProtKB:

Q52NJ2 (UniProtKB/Swiss-Prot), A0A4X1WAN7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQGSFNNVKQWLQEIDRYASENVNKLLVGNKCDL
TTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

hide sequence

Ensembl Acc Id:

ENSSSCP00000053998 ⟸ ENSSSCT00000059098

Ensembl Acc Id:

ENSSSCP00000074229 ⟸ ENSSSCT00000074694

Ensembl Acc Id:

ENSSSCP00000008922 ⟸ ENSSSCT00000009153

Ensembl Acc Id:

ENSSSCP00000019583 ⟸ ENSSSCT00000031971

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000008359	Ensembl, ENTREZGENE
Ensembl Transcript	ENSSSCT00000009153	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	ssc:595116	UniProtKB/Swiss-Prot
NCBI Gene	RAB1A	ENTREZGENE
PANTHER	RAS-RELATED PROTEIN RAB	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
SMART	ARF	UniProtKB/Swiss-Prot
	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A287BD00_PIG	UniProtKB/TrEMBL
	A0A4X1W4U3_PIG	UniProtKB/TrEMBL
	A0A4X1W4V7_PIG	UniProtKB/TrEMBL
	A0A4X1WAN7	ENTREZGENE, UniProtKB/TrEMBL
	A0A4X1WBU7_PIG	UniProtKB/TrEMBL
	A0A4X1WBV2_PIG	UniProtKB/TrEMBL
	A0A5G2Q820_PIG	UniProtKB/TrEMBL
	A0A5G2QA22_PIG	UniProtKB/TrEMBL
	A0A5G2QCI0_PIG	UniProtKB/TrEMBL
	A0A5G2QTM4_PIG	UniProtKB/TrEMBL
	A0A5G2RA85_PIG	UniProtKB/TrEMBL
	F2Z5U4_PIG	UniProtKB/TrEMBL
	I3L6D2_PIG	UniProtKB/TrEMBL
	Q52NJ2	ENTREZGENE, UniProtKB/Swiss-Prot
VGNC ID	VGNC:104042	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - MGI