Advanced Search (OLGA)

Gene: Adgre1 (adhesion G protein-coupled receptor E1) Rattus norvegicus

Analyze

Symbol:

Adgre1

Name:

adhesion G protein-coupled receptor E1

RGD ID:

1359214

Description:

Predicted to enable G protein-coupled receptor activity. Involved in cellular response to transforming growth factor beta stimulus and cellular response to tumor necrosis factor. Predicted to be located in external side of plasma membrane. Predicted to be active in plasma membrane. Orthologous to human ADGRE1 (adhesion G protein-coupled receptor E1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adhesion G protein-coupled receptor E2; cell surface glycoprotein EMR1; EGF-like module containing, mucin-like, hormone receptor-like 1; EGF-like module containing, mucin-like, hormone receptor-like sequence 1; EGF-like module receptor 1; EGF-like module-containing mucin-like hormone receptor-like 1; Emr1; EMR1 hormone receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	2,329,398 - 2,484,959 (+)	NCBI		GRCr8
mRatBN7.2	9	2,242,476 - 2,398,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	2,242,474 - 2,398,000 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	2,669,775 - 2,827,086 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	8,019,173 - 8,176,462 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,975,024 - 7,132,310 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	9,431,888 - 9,585,883 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	9,431,860 - 9,585,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	8,434,335 - 8,593,088 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	9	6,128,947 - 6,277,689 (-)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	mucolipidosis type IV		ISO	RGD:1342649	8554872	ClinVar Annotator: match by term: Mucolipidosis type IV	ClinVar	PMID:11030752\|PMID:11317355\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	Experimental Liver Cirrhosis		ISO	RGD:1342649	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	(-)-acanthoic acid	multiple interactions	ISO	RGD:1553497	6480464	acanthoic acid inhibits the reaction [Ethanol results in increased expression of ADGRE1 protein]	CTD	PMID:28964808
Adgre1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:1553497	6480464	epigallocatechin gallate inhibits the reaction [Pyruvaldehyde results in increased expression of ADGRE1 protein]	CTD	PMID:22101032
Adgre1	Rat	(2R,4R)-1-[(2S)-5-(diaminomethylideneamino)-2-[(3-methyl-1,2,3,4-tetrahydroquinolin-8-yl)sulfonylamino]-1-oxopentyl]-4-methyl-2-piperidinecarboxylic acid	multiple interactions	ISO	RGD:1553497	6480464	argatroban inhibits the reaction [Dietary Fats results in increased expression of ADGRE1 mRNA]	CTD	PMID:22841818
Adgre1	Rat	1,1-dichloroethene	increases expression	ISO	RGD:1553497	6480464	vinylidene chloride results in increased expression of ADGRE1 mRNA	CTD	PMID:26682919
Adgre1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1553497	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ADGRE1 mRNA	CTD	PMID:22206623
Adgre1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of ADGRE1 mRNA	CTD	PMID:25380136
Adgre1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1553497	6480464	Ethinyl Estradiol results in increased expression of ADGRE1 mRNA	CTD	PMID:12072388
Adgre1	Rat	17beta-estradiol	increases expression	ISO	RGD:1553497	6480464	Estradiol results in increased expression of ADGRE1 mRNA	CTD	PMID:19484750
Adgre1	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ADGRE1 mRNA	CTD	PMID:32741896
Adgre1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1553497	6480464	Estradiol results in decreased expression of ADGRE1 mRNA	CTD	PMID:39298647
Adgre1	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of ADGRE1 mRNA	CTD	PMID:32145629
Adgre1	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ADGRE1 mRNA	CTD	PMID:32741896
Adgre1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1553497	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of ADGRE1 mRNA	CTD	PMID:30294300
Adgre1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1553497	6480464	Tetrachlorodibenzodioxin results in increased expression of ADGRE1 mRNA	CTD	PMID:17320037\|PMID:22564538\|PMID:29043426\|PMID:30790002
Adgre1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ADGRE1 mRNA	CTD	PMID:34747641
Adgre1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1553497	6480464	AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of ADGRE1 mRNA]	CTD	PMID:30790002
Adgre1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1553497	6480464	Tetrachlorodibenzodioxin affects the expression of ADGRE1 mRNA	CTD	PMID:28922406
Adgre1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1553497	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of ADGRE1 mRNA	CTD	PMID:38648751
Adgre1	Rat	2-aminopurine	multiple interactions	ISO	RGD:1553497	6480464	2-Aminopurine affects the reaction [LEP protein affects the expression of ADGRE1 mRNA]	CTD	PMID:24150608
Adgre1	Rat	2-butoxyethanol	increases expression	ISO	RGD:1553497	6480464	n-butoxyethanol results in increased expression of ADGRE1 mRNA	CTD	PMID:19812364
Adgre1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	EXP		6480464	tetrabromobisphenol A results in decreased expression of ADGRE1 mRNA	CTD	PMID:28300664
Adgre1	Rat	3,3'-diindolylmethane	multiple interactions	ISO	RGD:1553497	6480464	3,3'-diindolylmethane inhibits the reaction [Lipopolysaccharides results in increased expression of ADGRE1 mRNA]	CTD	PMID:24162184
Adgre1	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4,4'-diaminodiphenylmethane results in increased expression of ADGRE1 mRNA	CTD	PMID:25380136\|PMID:30723492
Adgre1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1553497	6480464	bisphenol S results in increased expression of ADGRE1 mRNA	CTD	PMID:30951980
Adgre1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1553497	6480464	bisphenol S results in decreased methylation of ADGRE1 exon	CTD	PMID:33297965
Adgre1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1553497	6480464	bisphenol S results in decreased expression of ADGRE1 mRNA	CTD	PMID:39298647
Adgre1	Rat	acrylamide	increases expression	ISO	RGD:1553497	6480464	Acrylamide results in increased expression of ADGRE1 mRNA	CTD	PMID:30807115
Adgre1	Rat	adenine	increases expression	ISO	RGD:1553497	6480464	Adenine results in increased expression of ADGRE1 mRNA	CTD	PMID:34619300
Adgre1	Rat	aflatoxin B1	affects expression	ISO	RGD:1342649	6480464	Aflatoxin B1 affects the expression of ADGRE1 protein	CTD	PMID:20106945
Adgre1	Rat	aflatoxin B1	increases expression	ISO	RGD:1342649	6480464	Aflatoxin B1 results in increased expression of ADGRE1 mRNA	CTD	PMID:32234424
Adgre1	Rat	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of ADGRE1 mRNA	CTD	PMID:33354967
Adgre1	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	RGD:1342649	6480464	aflatoxin B2 results in decreased methylation of ADGRE1 intron	CTD	PMID:30157460
Adgre1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1342649	6480464	Tretinoin results in increased expression of ADGRE1 mRNA	CTD	PMID:15498508\|PMID:33167477
Adgre1	Rat	allyl methyl disulfide	multiple interactions	ISO	RGD:1553497	6480464	allyl methyl disulfide inhibits the reaction [Dimethylformamide results in increased expression of ADGRE1 protein]	CTD	PMID:37995826
Adgre1	Rat	amlexanox	multiple interactions	ISO	RGD:1553497	6480464	amlexanox inhibits the reaction [Palmitic Acid results in increased expression of ADGRE1 mRNA]	CTD	PMID:32905826
Adgre1	Rat	amlexanox	decreases expression	ISO	RGD:1553497	6480464	amlexanox results in decreased expression of ADGRE1 mRNA	CTD	PMID:32905826
Adgre1	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of ADGRE1 mRNA	CTD	PMID:30779732
Adgre1	Rat	argatroban	multiple interactions	ISO	RGD:1553497	6480464	argatroban inhibits the reaction [Dietary Fats results in increased expression of ADGRE1 mRNA]	CTD	PMID:22841818
Adgre1	Rat	Aroclor 1254	decreases expression	ISO	RGD:1553497	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of ADGRE1 mRNA	CTD	PMID:23650126
Adgre1	Rat	arsane	decreases response to substance	ISO	RGD:1342649	6480464	ADGRE1 mRNA results in decreased susceptibility to Arsenic	CTD	PMID:17976673
Adgre1	Rat	arsenic atom	decreases response to substance	ISO	RGD:1342649	6480464	ADGRE1 mRNA results in decreased susceptibility to Arsenic	CTD	PMID:17976673
Adgre1	Rat	arsenite(3-)	decreases expression	ISO	RGD:1553497	6480464	arsenite results in decreased expression of ADGRE1 mRNA	CTD	PMID:18191166
Adgre1	Rat	arsenous acid	increases expression	ISO	RGD:1553497	6480464	Arsenic Trioxide results in increased expression of ADGRE1 protein	CTD	PMID:30237538
Adgre1	Rat	arsenous acid	multiple interactions	ISO	RGD:1553497	6480464	Taurine inhibits the reaction [Arsenic Trioxide results in increased expression of ADGRE1 protein]	CTD	PMID:30237538
Adgre1	Rat	aspartame	multiple interactions	ISO	RGD:1553497	6480464	[Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of ADGRE1 mRNA	CTD	PMID:23783067
Adgre1	Rat	atorvastatin calcium	multiple interactions	ISO	RGD:1553497	6480464	Atorvastatin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of more ...	CTD	PMID:37023836
Adgre1	Rat	Bavachinin	multiple interactions	ISO	RGD:1553497	6480464	[Lipopolysaccharides co-treated with bavachinin] results in increased expression of ADGRE1 protein; N-(1,2,3,5,6,7-hexahydro-S-indacen-4-ylcarbamoyl)-4-(2-hydroxy-2-propanyl)-2-furansulfonamide inhibits the reaction more ...	CTD	PMID:38969277
Adgre1	Rat	benzene	increases expression	ISO	RGD:1553497	6480464	Benzene results in increased expression of ADGRE1 protein	CTD	PMID:36306860
Adgre1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1553497	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ADGRE1 mRNA]	CTD	PMID:22228805
Adgre1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1342649	6480464	Benzo(a)pyrene results in increased expression of ADGRE1 mRNA	CTD	PMID:32234424
Adgre1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1342649	6480464	Benzo(a)pyrene affects the methylation of ADGRE1 3' UTR; Benzo(a)pyrene affects the methylation of ADGRE1 promoter	CTD	PMID:27901495
Adgre1	Rat	benzo[a]pyrene	affects expression	ISO	RGD:1553497	6480464	Benzo(a)pyrene affects the expression of ADGRE1 mRNA	CTD	PMID:22342234
Adgre1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1553497	6480464	Benzo(a)pyrene results in increased expression of ADGRE1 mRNA	CTD	PMID:22228805
Adgre1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1553497	6480464	Diethylhexyl Phthalate promotes the reaction [Dietary Fats results in increased expression of ADGRE1 mRNA]	CTD	PMID:34303773
Adgre1	Rat	bisphenol A	increases expression	ISO	RGD:1553497	6480464	bisphenol A results in increased expression of ADGRE1 mRNA	CTD	PMID:27145005
Adgre1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ADGRE1 mRNA	CTD	PMID:32145629\|PMID:33296240
Adgre1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ADGRE1 mRNA	CTD	PMID:25181051
Adgre1	Rat	bisphenol F	increases expression	ISO	RGD:1553497	6480464	bisphenol F results in increased expression of ADGRE1 mRNA	CTD	PMID:38685157
Adgre1	Rat	butanal	increases expression	ISO	RGD:1342649	6480464	butyraldehyde results in increased expression of ADGRE1 mRNA	CTD	PMID:26079696
Adgre1	Rat	cadmium atom	decreases expression	ISO	RGD:1342649	6480464	Cadmium results in decreased expression of ADGRE1 mRNA	CTD	PMID:24376830
Adgre1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of ADGRE1 mRNA	CTD	PMID:25993096
Adgre1	Rat	carbon nanotube	increases expression	ISO	RGD:1553497	6480464	Nanotubes, Carbon results in increased expression of ADGRE1 mRNA	CTD	PMID:25554681
Adgre1	Rat	carbon nanotube	affects expression	ISO	RGD:1553497	6480464	Nanotubes, Carbon affects the expression of ADGRE1 mRNA; Nanotubes, Carbon analog affects the expression of more ...	CTD	PMID:25554681\|PMID:25620056
Adgre1	Rat	carbon nanotube	decreases expression	ISO	RGD:1553497	6480464	Nanotubes, Carbon analog results in decreased expression of ADGRE1 mRNA	CTD	PMID:25620056
Adgre1	Rat	carnosic acid	multiple interactions	ISO	RGD:1553497	6480464	salvin inhibits the reaction [sodium arsenite results in decreased expression of ADGRE1 mRNA]	CTD	PMID:35202923
Adgre1	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of ADGRE1 mRNA	CTD	PMID:18500788
Adgre1	Rat	celastrol	multiple interactions	ISO	RGD:1553497	6480464	[celastrol co-treated with coomassie Brilliant Blue] inhibits the reaction [Acetaminophen results in increased expression of more ...	CTD	PMID:28435131
Adgre1	Rat	choline	multiple interactions	ISO	RGD:1553497	6480464	[Choline deficiency co-treated with Methionine deficiency] results in increased expression of ADGRE1 mRNA; [Methionine deficiency more ...	CTD	PMID:20697377\|PMID:25178843\|PMID:27984176\|PMID:37023836
Adgre1	Rat	ciguatoxin CTX1B	affects expression	ISO	RGD:1553497	6480464	Ciguatoxins affects the expression of ADGRE1 mRNA	CTD	PMID:18353800
Adgre1	Rat	cisplatin	increases expression	ISO	RGD:1342649	6480464	Cisplatin results in increased expression of ADGRE1 mRNA	CTD	PMID:27392435\|PMID:27594783
Adgre1	Rat	cobalt atom	multiple interactions	ISO	RGD:1553497	6480464	[Zinc co-treated with Nickel co-treated with Cobalt] affects the reaction [Dietary Fats affects the expression more ...	CTD	PMID:23503329
Adgre1	Rat	cocaine	affects expression	EXP		6480464	Cocaine affects the expression of ADGRE1 mRNA	CTD	PMID:20187946
Adgre1	Rat	conjugated linoleic acid	increases expression	ISO	RGD:1553497	6480464	Linoleic Acids, Conjugated results in increased expression of ADGRE1 mRNA; Linoleic Acids, Conjugated results in more ...	CTD	PMID:17322064
Adgre1	Rat	copper atom	multiple interactions	EXP		6480464	[gadolinium chloride co-treated with Fructose co-treated with Copper deficiency] results in decreased expression of ADGRE1 more ...	CTD	PMID:25813056
Adgre1	Rat	copper(0)	multiple interactions	EXP		6480464	[gadolinium chloride co-treated with Fructose co-treated with Copper deficiency] results in decreased expression of ADGRE1 more ...	CTD	PMID:25813056
Adgre1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of ADGRE1 mRNA	CTD	PMID:27523638
Adgre1	Rat	curcumin	decreases expression	ISO	RGD:1553497	6480464	Curcumin results in decreased expression of ADGRE1 mRNA	CTD	PMID:18403477
Adgre1	Rat	dextran sulfate	increases expression	ISO	RGD:1553497	6480464	Dextran Sulfate results in increased expression of ADGRE1 protein	CTD	PMID:38583725
Adgre1	Rat	dextran sulfate	multiple interactions	ISO	RGD:1553497	6480464	flavokawain B inhibits the reaction [Dextran Sulfate results in increased expression of ADGRE1 protein]	CTD	PMID:38583725
Adgre1	Rat	diarsenic trioxide	multiple interactions	ISO	RGD:1553497	6480464	Taurine inhibits the reaction [Arsenic Trioxide results in increased expression of ADGRE1 protein]	CTD	PMID:30237538
Adgre1	Rat	diarsenic trioxide	increases expression	ISO	RGD:1553497	6480464	Arsenic Trioxide results in increased expression of ADGRE1 protein	CTD	PMID:30237538
Adgre1	Rat	diethyl phthalate	decreases expression	EXP		6480464	diethyl phthalate results in decreased expression of ADGRE1 mRNA	CTD	PMID:32341500
Adgre1	Rat	dioxygen	multiple interactions	EXP		6480464	[Blood Glucose deficiency co-treated with Oxygen deficiency] results in increased expression of ADGRE1 mRNA	CTD	PMID:27693381
Adgre1	Rat	dioxygen	decreases expression	ISO	RGD:1553497	6480464	Oxygen deficiency results in decreased expression of ADGRE1 mRNA	CTD	PMID:23539316
Adgre1	Rat	emodin	multiple interactions	ISO	RGD:1553497	6480464	Emodin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of more ...	CTD	PMID:37023836
Adgre1	Rat	erlotinib hydrochloride	multiple interactions	ISO	RGD:1342649	6480464	[Interleukin 1 Receptor Antagonist Protein co-treated with Erlotinib Hydrochloride] results in decreased expression of ADGRE1 more ...	CTD	PMID:27738319
Adgre1	Rat	ethanol	increases expression	ISO	RGD:1553497	6480464	Ethanol results in increased expression of ADGRE1 mRNA; Ethanol results in increased expression of ADGRE1 more ...	CTD	PMID:26858005\|PMID:28882574\|PMID:28964808\|PMID:30319688
Adgre1	Rat	ethanol	multiple interactions	ISO	RGD:1553497	6480464	acanthoic acid inhibits the reaction [Ethanol results in increased expression of ADGRE1 protein]; Ethanol promotes more ...	CTD	PMID:26858005\|PMID:28882574\|PMID:28964808
Adgre1	Rat	ethanol	affects expression	ISO	RGD:1553497	6480464	Ethanol affects the expression of ADGRE1 protein	CTD	PMID:28843478
Adgre1	Rat	ferric oxide	increases expression	ISO	RGD:1553497	6480464	ferric oxide analog results in increased expression of ADGRE1 mRNA	CTD	PMID:24525745
Adgre1	Rat	flavokawain B	multiple interactions	ISO	RGD:1553497	6480464	flavokawain B inhibits the reaction [Dextran Sulfate results in increased expression of ADGRE1 protein]	CTD	PMID:38583725
Adgre1	Rat	folic acid	multiple interactions	ISO	RGD:1553497	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ADGRE1 mRNA; Metformin inhibits the more ...	CTD	PMID:22206623\|PMID:29380373
Adgre1	Rat	folic acid	increases expression	ISO	RGD:1553497	6480464	Folic Acid results in increased expression of ADGRE1 mRNA	CTD	PMID:29380373\|PMID:34619300
Adgre1	Rat	fructose	multiple interactions	EXP		6480464	[gadolinium chloride co-treated with Fructose co-treated with Copper deficiency] results in decreased expression of ADGRE1 more ...	CTD	PMID:25813056
Adgre1	Rat	fructose	multiple interactions	ISO	RGD:1553497	6480464	Ethanol promotes the reaction [Fructose results in increased expression of ADGRE1 protein]; Fructose promotes the more ...	CTD	PMID:26858005
Adgre1	Rat	fructose	increases expression	ISO	RGD:1553497	6480464	Fructose results in increased expression of ADGRE1 protein	CTD	PMID:26858005
Adgre1	Rat	gadolinium trichloride	multiple interactions	EXP		6480464	[gadolinium chloride co-treated with Fructose co-treated with Copper deficiency] results in decreased expression of ADGRE1 more ...	CTD	PMID:25813056
Adgre1	Rat	gadolinium trichloride	multiple interactions	ISO	RGD:1553497	6480464	gadolinium chloride inhibits the reaction [Ethanol results in increased expression of ADGRE1 protein]	CTD	PMID:28882574
Adgre1	Rat	GW 4064	decreases expression	ISO	RGD:1553497	6480464	GW 4064 results in decreased expression of ADGRE1 mRNA	CTD	PMID:23371517
Adgre1	Rat	hexadecanoic acid	multiple interactions	ISO	RGD:1553497	6480464	amlexanox inhibits the reaction [Palmitic Acid results in increased expression of ADGRE1 mRNA]	CTD	PMID:32905826
Adgre1	Rat	hexadecanoic acid	increases expression	ISO	RGD:1553497	6480464	Palmitic Acid results in increased expression of ADGRE1 mRNA	CTD	PMID:32905826
Adgre1	Rat	L-methionine	multiple interactions	ISO	RGD:1553497	6480464	[Choline deficiency co-treated with Methionine deficiency] results in increased expression of ADGRE1 mRNA; [Methionine deficiency more ...	CTD	PMID:20697377\|PMID:25178843\|PMID:27984176\|PMID:37023836
Adgre1	Rat	lipopolysaccharide	increases expression	ISO	RGD:1553497	6480464	Lipopolysaccharides results in increased expression of ADGRE1 mRNA	CTD	PMID:24162184\|PMID:27339419\|PMID:37182445
Adgre1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1553497	6480464	3,3'-diindolylmethane inhibits the reaction [Lipopolysaccharides results in increased expression of ADGRE1 mRNA]; [Lipopolysaccharides co-treated with more ...	CTD	PMID:24162184\|PMID:37182445\|PMID:38969277
Adgre1	Rat	manganese atom	increases expression	EXP		6480464	Manganese results in increased expression of ADGRE1 mRNA	CTD	PMID:20224926
Adgre1	Rat	manganese(0)	increases expression	EXP		6480464	Manganese results in increased expression of ADGRE1 mRNA	CTD	PMID:20224926
Adgre1	Rat	metformin	multiple interactions	ISO	RGD:1553497	6480464	Metformin inhibits the reaction [Folic Acid results in increased expression of ADGRE1 mRNA]	CTD	PMID:29380373
Adgre1	Rat	methotrexate	affects expression	ISO	RGD:1553497	6480464	Methotrexate affects the expression of ADGRE1 mRNA	CTD	PMID:18502557
Adgre1	Rat	methylglyoxal	multiple interactions	ISO	RGD:1553497	6480464	epigallocatechin gallate inhibits the reaction [Pyruvaldehyde results in increased expression of ADGRE1 protein]	CTD	PMID:22101032
Adgre1	Rat	methylglyoxal	increases expression	ISO	RGD:1553497	6480464	Pyruvaldehyde results in increased expression of ADGRE1 protein	CTD	PMID:22101032
Adgre1	Rat	monosodium L-glutamate	multiple interactions	ISO	RGD:1553497	6480464	[Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of ADGRE1 mRNA	CTD	PMID:23783067
Adgre1	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of ADGRE1 mRNA	CTD	PMID:21515302
Adgre1	Rat	N,N-dimethylformamide	multiple interactions	ISO	RGD:1553497	6480464	allyl methyl disulfide inhibits the reaction [Dimethylformamide results in increased expression of ADGRE1 protein]	CTD	PMID:37995826
Adgre1	Rat	N,N-dimethylformamide	increases expression	ISO	RGD:1553497	6480464	Dimethylformamide results in increased expression of ADGRE1 protein	CTD	PMID:37995826
Adgre1	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of ADGRE1 mRNA	CTD	PMID:25380136
Adgre1	Rat	N-Nitrosopyrrolidine	increases expression	ISO	RGD:1342649	6480464	N-Nitrosopyrrolidine results in increased expression of ADGRE1 mRNA	CTD	PMID:32234424
Adgre1	Rat	nickel atom	multiple interactions	ISO	RGD:1553497	6480464	[Zinc co-treated with Nickel co-treated with Cobalt] affects the reaction [Dietary Fats affects the expression more ...	CTD	PMID:23503329
Adgre1	Rat	okadaic acid	increases expression	ISO	RGD:1342649	6480464	Okadaic Acid results in increased expression of ADGRE1 mRNA	CTD	PMID:38832940
Adgre1	Rat	olaparib	multiple interactions	ISO	RGD:1553497	6480464	olaparib inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of more ...	CTD	PMID:27984176
Adgre1	Rat	oxycodone	decreases expression	EXP		6480464	Oxycodone results in decreased expression of ADGRE1 mRNA	CTD	PMID:23439660
Adgre1	Rat	ozone	multiple interactions	ISO	RGD:1553497	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549
Adgre1	Rat	ozone	multiple interactions	ISO	RGD:1342649	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of ADGRE1 mRNA	CTD	PMID:35430440
Adgre1	Rat	paracetamol	decreases expression	ISO	RGD:1553497	6480464	Acetaminophen results in decreased expression of ADGRE1 protein	CTD	PMID:22575169
Adgre1	Rat	paracetamol	increases expression	ISO	RGD:1553497	6480464	Acetaminophen results in increased expression of ADGRE1 protein	CTD	PMID:28435131
Adgre1	Rat	paracetamol	multiple interactions	ISO	RGD:1553497	6480464	[celastrol co-treated with coomassie Brilliant Blue] inhibits the reaction [Acetaminophen results in increased expression of more ...	CTD	PMID:22575169\|PMID:28435131
Adgre1	Rat	phenobarbital	multiple interactions	ISO	RGD:1553497	6480464	NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of ADGRE1 mRNA]	CTD	PMID:19482888
Adgre1	Rat	phenobarbital	decreases expression	ISO	RGD:1553497	6480464	Phenobarbital results in decreased expression of ADGRE1 mRNA	CTD	PMID:19482888
Adgre1	Rat	pirinixic acid	decreases expression	ISO	RGD:1553497	6480464	pirinixic acid results in decreased expression of ADGRE1 mRNA	CTD	PMID:18445702\|PMID:20813756
Adgre1	Rat	propanal	increases expression	ISO	RGD:1342649	6480464	propionaldehyde results in increased expression of ADGRE1 mRNA	CTD	PMID:26079696
Adgre1	Rat	quercetin	multiple interactions	ISO	RGD:1553497	6480464	Quercetin inhibits the reaction [Dietary Fats results in increased expression of ADGRE1 mRNA]	CTD	PMID:24465016\|PMID:25614714
Adgre1	Rat	Rhein	multiple interactions	ISO	RGD:1553497	6480464	rhein inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of more ...	CTD	PMID:37023836
Adgre1	Rat	rimonabant	decreases expression	EXP		6480464	Rimonabant results in decreased expression of ADGRE1 mRNA	CTD	PMID:30365523
Adgre1	Rat	Salvianolic acid A	multiple interactions	ISO	RGD:1553497	6480464	salvianolic acid A affects the reaction [[Streptozocin co-treated with [APOE protein affects the susceptibility to more ...	CTD	PMID:39047806
Adgre1	Rat	silicon dioxide	multiple interactions	ISO	RGD:1553497	6480464	GAS6 protein affects the reaction [Silicon Dioxide results in increased expression of ADGRE1 mRNA]; GAS6 more ...	CTD	PMID:31284023\|PMID:34843873
Adgre1	Rat	silicon dioxide	increases expression	ISO	RGD:1553497	6480464	Silicon Dioxide results in increased expression of ADGRE1 mRNA; Silicon Dioxide results in increased expression more ...	CTD	PMID:31284023\|PMID:34843873
Adgre1	Rat	sodium arsenite	decreases expression	ISO	RGD:1553497	6480464	sodium arsenite results in decreased expression of ADGRE1 mRNA	CTD	PMID:35202923
Adgre1	Rat	sodium arsenite	increases expression	ISO	RGD:1553497	6480464	sodium arsenite results in increased expression of ADGRE1 mRNA; sodium arsenite results in increased expression more ...	CTD	PMID:29044176\|PMID:36209798
Adgre1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1553497	6480464	salvin inhibits the reaction [sodium arsenite results in decreased expression of ADGRE1 mRNA]	CTD	PMID:35202923
Adgre1	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of ADGRE1 mRNA	CTD	PMID:19281266
Adgre1	Rat	streptozocin	multiple interactions	EXP		6480464	stannous mesoporphyrin inhibits the reaction [4-(4-(3-adamantan-1-ylureido)cyclohexyloxy)benzoic acid inhibits the reaction [Streptozocin results in increased expression more ...	CTD	PMID:23611540
Adgre1	Rat	streptozocin	increases expression	ISO	RGD:1553497	6480464	Streptozocin results in increased expression of ADGRE1 mRNA	CTD	PMID:29420703
Adgre1	Rat	streptozocin	multiple interactions	ISO	RGD:1553497	6480464	[fatostatin co-treated with Streptozocin] results in increased expression of ADGRE1 mRNA; [Streptozocin co-treated with [APOE more ...	CTD	PMID:29420703\|PMID:39047806
Adgre1	Rat	streptozocin	increases expression	EXP		6480464	Streptozocin results in increased expression of ADGRE1 protein	CTD	PMID:23611540
Adgre1	Rat	tamibarotene	increases expression	ISO	RGD:1342649	6480464	tamibarotene results in increased expression of ADGRE1 mRNA	CTD	PMID:15498508
Adgre1	Rat	taurine	multiple interactions	ISO	RGD:1553497	6480464	Taurine inhibits the reaction [Arsenic Trioxide results in increased expression of ADGRE1 protein]	CTD	PMID:30237538
Adgre1	Rat	temozolomide	decreases expression	ISO	RGD:1342649	6480464	Temozolomide results in decreased expression of ADGRE1 mRNA	CTD	PMID:31758290
Adgre1	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of ADGRE1 mRNA	CTD	PMID:21515302
Adgre1	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ADGRE1 mRNA	CTD	PMID:32741896
Adgre1	Rat	tetrachloroethene	increases expression	ISO	RGD:1553497	6480464	Tetrachloroethylene results in increased expression of ADGRE1 mRNA	CTD	PMID:28973375
Adgre1	Rat	tetrachloromethane	multiple interactions	ISO	RGD:1553497	6480464	MGLL protein affects the reaction [Carbon Tetrachloride results in increased expression of ADGRE1 mRNA]; TBXA2R more ...	CTD	PMID:22206755\|PMID:30301768
Adgre1	Rat	tetrachloromethane	affects expression	ISO	RGD:1553497	6480464	Carbon Tetrachloride affects the expression of ADGRE1 mRNA	CTD	PMID:31919559
Adgre1	Rat	tetrachloromethane	increases expression	ISO	RGD:1553497	6480464	Carbon Tetrachloride results in increased expression of ADGRE1 mRNA; Carbon Tetrachloride results in increased expression more ...	CTD	PMID:22206755\|PMID:27339419\|PMID:29987408\|PMID:30301768
Adgre1	Rat	thioacetamide	affects expression	EXP		6480464	Thioacetamide affects the expression of ADGRE1 mRNA	CTD	PMID:34492290
Adgre1	Rat	titanium dioxide	increases expression	ISO	RGD:1553497	6480464	titanium dioxide results in increased expression of ADGRE1 mRNA	CTD	PMID:23557971
Adgre1	Rat	titanium dioxide	decreases expression	ISO	RGD:1553497	6480464	titanium dioxide results in decreased expression of ADGRE1 mRNA	CTD	PMID:27760801\|PMID:29264374
Adgre1	Rat	topotecan	increases expression	EXP		6480464	Topotecan results in increased expression of ADGRE1 mRNA	CTD	PMID:25729387
Adgre1	Rat	triphenyl phosphate	decreases expression	EXP		6480464	triphenyl phosphate results in decreased expression of ADGRE1 mRNA	CTD	PMID:30589522
Adgre1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1342649	6480464	triphenyl phosphate affects the expression of ADGRE1 mRNA	CTD	PMID:37042841
Adgre1	Rat	Triptolide	decreases expression	ISO	RGD:1553497	6480464	triptolide results in decreased expression of ADGRE1 mRNA	CTD	PMID:36520315
Adgre1	Rat	Triptolide	multiple interactions	ISO	RGD:1553497	6480464	STING1 protein affects the reaction [triptolide results in decreased expression of ADGRE1 mRNA]	CTD	PMID:36520315
Adgre1	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of ADGRE1 mRNA	CTD	PMID:21515302
Adgre1	Rat	valproic acid	decreases methylation	ISO	RGD:1342649	6480464	Valproic Acid results in decreased methylation of ADGRE1 gene	CTD	PMID:29154799
Adgre1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of ADGRE1 mRNA	CTD	PMID:23034163
Adgre1	Rat	zinc atom	multiple interactions	ISO	RGD:1553497	6480464	[Zinc co-treated with Nickel co-treated with Cobalt] affects the reaction [Dietary Fats affects the expression more ...	CTD	PMID:23503329
Adgre1	Rat	zinc dichloride	multiple interactions	ISO	RGD:1553497	6480464	N-(oxo-5,6-dihydrophenanthridin-2-yl)-N,N-dimethylacetamide hydrochloride inhibits the reaction [zinc chloride results in increased expression of ADGRE1 protein]; NCF1 more ...	CTD	PMID:18509044
Adgre1	Rat	zinc dichloride	increases expression	ISO	RGD:1553497	6480464	zinc chloride results in increased expression of ADGRE1 protein	CTD	PMID:18509044
Adgre1	Rat	zinc(0)	multiple interactions	ISO	RGD:1553497	6480464	[Zinc co-treated with Nickel co-treated with Cobalt] affects the reaction [Dietary Fats affects the expression more ...	CTD	PMID:23503329

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	adaptive immune response	involved_in	IEA	UniProtKB-KW:KW-1064	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adgre1	Rat	adenylate cyclase-activating G protein-coupled receptor signaling pathway	involved_in	IBA	MGI:1916151\|PANTHER:PTN000244280\|UniProtKB:Q6QNK2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adgre1	Rat	cell surface receptor signaling pathway	involved_in	IEA	InterPro:IPR017981	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adgre1	Rat	cellular response to transforming growth factor beta stimulus		IEP		151665477		RGD
Adgre1	Rat	cellular response to tumor necrosis factor		IEP		151665477		RGD
Adgre1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adgre1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000832\|InterPro:IPR001740\|InterPro:IPR017983	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adgre1	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adgre1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	cell periphery	located_in	ISO	RGD:1553497	1624291	PMID:21464233	RGD	PMID:21464233
Adgre1	Rat	cell periphery	located_in	IEA	UniProtKB:Q61549\|ensembl:ENSMUSP00000083971	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Adgre1	Rat	external side of plasma membrane	located_in	IEA	UniProtKB:Q61549\|ensembl:ENSMUSP00000083971	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Adgre1	Rat	external side of plasma membrane	located_in	ISO	RGD:1553497	1624291	PMID:10943842, PMID:11911823, PMID:11911824, PMID:12163569	RGD	PMID:10943842\|PMID:11911823\|PMID:11911824\|PMID:12163569
Adgre1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adgre1	Rat	membrane	located_in	IEA	InterPro:IPR000832\|InterPro:IPR001740\|InterPro:IPR017981	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adgre1	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0033313\|FB:FBgn0039818\|FB:FBgn0039821\|MGI:106912\|MGI:1347095\|MGI:1933736\|MGI:2139714\|MGI:2441837\|MGI:2441950\|PANTHER:PTN002279899\|RGD:1305608\|RGD:620768\|RGD:621136\|RGD:628618\|UniProtKB:O14514\|UniProtKB:O60241\|UniProtKB:O60242\|UniProtKB:Q6QNK2\|UniProtKB:Q86SQ4\|UniProtKB:Q86Y34\|UniProtKB:Q8IZP9\|UniProtKB:Q9HAR2\|UniProtKB:Q9UHX3\|WB:WBGene00002251	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adgre1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q61549\|ensembl:ENSMUSP00000083971	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Adgre1	Rat	plasma membrane	located_in	ISO	RGD:1553497	1624291	PMID:23762286	RGD	PMID:23762286
Adgre1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Adgre1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adgre1	Rat	calcium ion binding	enables	IEA	InterPro:IPR001881\|InterPro:IPR018097	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adgre1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adgre1	Rat	G protein-coupled receptor activity	enables	IBA	MGI:1340051\|PANTHER:PTN000244280\|RGD:620768\|UniProtKB:O14514\|UniProtKB:O60241\|UniProtKB:Q6QNK2\|UniProtKB:Q86SQ4\|ZFIN:ZDB-GENE-041014-357	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adgre1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000832\|InterPro:IPR001740\|InterPro:IPR017983	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adgre1	Rat	transmembrane signaling receptor activity	enables	IEA	InterPro:IPR017981	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

mucolipidosis type IV (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-acanthoic acid (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(2R,4R)-1-[(2S)-5-(diaminomethylideneamino)-2-[(3-methyl-1,2,3,4-tetrahydroquinolin-8-yl)sulfonylamino]-1-oxopentyl]-4-methyl-2-piperidinecarboxylic acid (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-aminopurine (ISO)

2-butoxyethanol (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,3'-diindolylmethane (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

adenine (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

allyl methyl disulfide (ISO)

amlexanox (ISO)

amphetamine (EXP)

argatroban (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

aspartame (ISO)

atorvastatin calcium (ISO)

Bavachinin (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

carnosic acid (ISO)

cefaloridine (EXP)

celastrol (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt atom (ISO)

cocaine (EXP)

conjugated linoleic acid (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

curcumin (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diethyl phthalate (EXP)

dioxygen (EXP,ISO)

emodin (ISO)

erlotinib hydrochloride (ISO)

ethanol (ISO)

ferric oxide (ISO)

flavokawain B (ISO)

folic acid (ISO)

fructose (EXP,ISO)

gadolinium trichloride (EXP,ISO)

GW 4064 (ISO)

hexadecanoic acid (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

manganese atom (EXP)

manganese(0) (EXP)

metformin (ISO)

methotrexate (ISO)

methylglyoxal (ISO)

monosodium L-glutamate (ISO)

Muraglitazar (EXP)

N,N-dimethylformamide (ISO)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

okadaic acid (ISO)

olaparib (ISO)

oxycodone (EXP)

ozone (ISO)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propanal (ISO)

quercetin (ISO)

Rhein (ISO)

rimonabant (EXP)

Salvianolic acid A (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (EXP,ISO)

tamibarotene (ISO)

taurine (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

troglitazone (EXP)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA)

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA)

cell surface receptor signaling pathway (IEA)

cellular response to transforming growth factor beta stimulus (IEP)

cellular response to tumor necrosis factor (IEP)

G protein-coupled receptor signaling pathway (IEA)

immune system process (IEA)

signal transduction (IEA)

Cellular Component

cell periphery (IEA,ISO)

external side of plasma membrane (IEA,ISO)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

calcium ion binding (IEA)

G protein-coupled receptor activity (IBA,IEA)

transmembrane signaling receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterization and identification of subpopulations of mononuclear preosteoclasts induced by TNF-α in combination with TGF-β in rats.	Matsubara R, etal., PLoS One. 2012;7(10):e47930. doi: 10.1371/journal.pone.0047930. Epub 2012 Oct 24.
3.	Molecular cloning of F4/80, a murine macrophage-restricted cell surface glycoprotein with homology to the G-protein-linked transmembrane 7 hormone receptor family.	McKnight AJ, etal., J Biol Chem 1996 Jan 5;271(1):486-9.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10943842	PMID:11911823	PMID:11911824	PMID:12163569	PMID:15578266	PMID:21464233	PMID:23762286	PMID:24913911

Genomics

Comparative Map Data

Adgre1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	2,329,398 - 2,484,959 (+)	NCBI		GRCr8
mRatBN7.2	9	2,242,476 - 2,398,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	2,242,474 - 2,398,000 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	2,669,775 - 2,827,086 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	8,019,173 - 8,176,462 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,975,024 - 7,132,310 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	9,431,888 - 9,585,883 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	9,431,860 - 9,585,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	8,434,335 - 8,593,088 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	9	6,128,947 - 6,277,689 (-)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

ADGRE1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	6,887,579 - 6,940,450 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	6,887,566 - 6,940,459 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	6,887,590 - 6,940,461 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	6,838,582 - 6,891,464 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	6,838,581 - 6,891,463	NCBI
Celera	19	6,829,806 - 6,881,535 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3-p13.2	NCBI
HuRef	19	6,649,934 - 6,703,041 (+)	NCBI		HuRef
CHM1_1	19	6,887,377 - 6,940,296 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	6,876,897 - 6,929,770 (+)	NCBI		T2T-CHM13v2.0

Adgre1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	57,665,650 - 57,790,527 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	57,665,691 - 57,790,527 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	57,358,581 - 57,483,529 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	57,358,691 - 57,483,527 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	57,498,109 - 57,622,952 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	57,044,026 - 57,168,862 (+)	NCBI		MGSCv36	mm8
Celera	17	61,708,492 - 61,834,039 (+)	NCBI		Celera
Cytogenetic Map	17	D	NCBI
cM Map	17	29.8	NCBI

Adgre1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955495	2,601,413 - 2,674,738 (-)	NCBI	ChiLan1.0	ChiLan1.0

ADGRE1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	11,298,860 - 11,350,817 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	10,524,065 - 10,577,171 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	5,918,097 - 5,970,069 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	6,838,787 - 6,891,292 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	6,838,787 - 6,891,292 (+)	Ensembl	panpan1.1		panPan2

ADGRE1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	53,404,096 - 53,465,267 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	53,404,457 - 53,465,243 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	53,154,280 - 53,214,040 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	54,058,184 - 54,120,272 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	54,058,548 - 54,120,242 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	53,126,876 - 53,187,421 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	53,574,601 - 53,635,395 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	53,803,931 - 53,864,739 (-)	NCBI		UU_Cfam_GSD_1.0

Adgre1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	213,665,444 - 213,704,306 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	4,138,872 - 4,167,069 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	4,127,497 - 4,169,323 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADGRE1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	72,217,036 - 72,305,925 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	72,699,549 - 72,739,448 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADGRE1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	6,444,621 - 6,499,438 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	1,452,580 - 1,539,330 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adgre1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624828	3,930,483 - 3,981,966 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adgre1
1533 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	37
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000073926
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	14209783	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat

Markers in Region

RH139937

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	2,397,687 - 2,397,876 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	9,432,012 - 9,432,200	NCBI	Rnor6.0
Rnor_5.0	9	8,434,459 - 8,434,647	UniSTS	Rnor5.0
Celera	9	6,129,071 - 6,129,259	UniSTS
Cytogenetic Map	9	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	45	113	91	90	59	25	59	6	214	93	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006244280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY686632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073926 ⟹ ENSRNOP00000067220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	2,242,474 - 2,398,000 (+)	Ensembl
Rnor_6.0 Ensembl	9	9,431,860 - 9,585,865 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105310 ⟹ ENSRNOP00000084080

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	2,242,474 - 2,398,000 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107295 ⟹ ENSRNOP00000080360

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	2,254,541 - 2,395,812 (+)	Ensembl

RefSeq Acc Id:

NM_001007557 ⟹ NP_001007558

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	2,329,440 - 2,484,959 (+)	NCBI
mRatBN7.2	9	2,242,476 - 2,398,000 (+)	NCBI
Rnor_6.0	9	9,431,888 - 9,585,852 (-)	NCBI
Rnor_5.0	9	8,434,335 - 8,593,088 (-)	NCBI
Celera	9	6,128,947 - 6,277,689 (-)	RGD

Sequence:

show sequence

AGTGAATAGTTGCCACAGTATAATGTGGGGCTTTTGGCTGCTCCTCTTCTGGGGCTTCAGTGGA
ACGCACAGATGGGGGATGACCACACTTGCCATCCTGGGACAAAGACTTAACGGTGTGAATGAAT
GTCAAGACACTACCACTTGTCCAGCTTATGCCACCTGCACTGACACCACGGAGAGTTATTACTG
TACCTGTAAACAAGGTTTTCTGCCCAGCAATGGACAAACCAACTTTCAGGGCCCAGGAGTGGAA
TGTCAAGATGTTAATGAATGTCTTAGAAGCGACTCGCCTTGTGGTTCTAACTCAGTCTGCACCA
ATATCCCAGGACGAGCCAGGTGCAGTTGTCTTAGTGGCTTCTCTTCTTCCGCTGGTGGAAGTTG
GATCCTGGGAAGTCCGGGTCATTTTCTCTGCACAGATGTTGACGAGTGTCTGACAATTGGGATC
TGCCCTAAGAATTCTAACTGCTCTAACTCTGTGGGGAGCTACAGCTGCACCTGCCAATCAGGCT
TTGTCTCGAATGGCTCCACTTGTGAAGATGAAGATGAATGTGTGACTCGTAATGCTTGCCCAGA
GCATGCAACCTGCCACAACACTCTTGGAAGCTATTATTGTACATGCAACGAAGGACTTGAATTT
AGTGGAGGAGGACCAATGTTCCAGGGCCTGGAAGAATCTTGTGAAGATGTGGATGAGTGCTCCA
GGAATTCAACGCTTTGTGGTCCCTCCTTCATTTGCATCAACACGCTGGGATCCTACAGCTGTTC
TTGCCCAGCTGGATTCTCTTTGTCAACTTTTCAGATCCCTGGTCATCCAGCAGATGGGAATTGT
ACAGATATAGATGAGTGTGATGACATATGCCCTTCCAACTCATCATGTACCAACACCCTTGGGA
GCTACTTCTGCACTTGCCACCCTGGCTTTGCCTCAAGCAATGGACAGCTGAATTTCACAGACCA
AGAAGTGACATGTGAAGATATTGATGAGTGCACTCAAGATCCATTTCGATGTGGACGAAATTCT
TCCTGCACCAATGTACCAGGTTCCTACAACTGCAGCTGTCTTCCCGACTTTCGAATGGATCCAG
GAGGCTCCCAAGCACATGGAAACTTCACATGCAAAAGGATTCCCTTCAAGTGTAAGGAAGACTT
GATACCCAAAAGTGAGCAGATAGAGCAGTGCCAAGCAGGGCAAGGCCGGAATCTTGATTATACT
TCCTTCTGCACATTTGTGAATGCCACCTTTACCATCCTGGATAACACCTGTGAAAACAAAAGTG
CTCCAGTGTCCTTACAGAGTGCAGCTACAAGTGTCTCCCTCATGCTGGAGCAAGCATCGACCTG
GTTTGAGTTCAGCAGGGAAGAGACATCTACTCTGGGCACTATCTTGCTGGAGACTGTGGAAAGC
ACCATGTTGGCTGCTCTTCTGACACCCTCTGGGAATGCCAGTCAGACCATTCGGACGGAGTACT
TGGAAATTGAAAGCAAAGTCATCAATGAAGAATGCAATGAGGAGAATGTGTCCATTAACTTGAA
AGCCAGAGGGGACAAGATGGATGTTGGCTGTTTCATAATCAAAGAATCAGAATCTACAGGGACC
CCAGGAGTGGCTTTTGTCTCCTTTGCACACATGGACTCAGTTTTAGATGAGCGCTTCTTTGAAG
ATGGTCAGGCCTCCTGGAAACTGAGGATGAATTCCCATGTTGTTGGTGGCACTGTAACCGGGGA
GAGGAAGGAGGACTTCTCCAAGCCTATCGTCTATACCCTCCAGCACATCCAGCCAAAGCAGAAG
TCTGAGAGGTCTATATGTGTCTCCTGGAACACCGATGTGGAGGATGGGAGATGGACACCCTCGG
GCTGTGAGACTGTAGAAGCATCTGAGACACACACAGTCTGCAGCTGTAACCGGATGACAAATTT
GGCCATCATCATGGCTTCTGGGGAGCTTACAATGGAATTTTCCTTGTATATCATCAGCTATGTG
GGTACAGTCATCTCTCTGGTATGTCTCGCCTTGGCCATAGCCACCTTCCTGTTGTTTCGTGCAG
TTCAGAACCACAACACCTACCTGCACCTGCACCTTTGTGTGTGTCTCTTCTTGGCCAAGATTCT
CTTCCTCACCGGTATAGACAAGACTGACAACCAGACAGCTTGCGCTATCATTGCGGGATTTCTA
CACTATCTTTTCCTTGCCTGCTTCTTCTGGATGCTGGTGGAGGCAGTGATGCTCTTCCTGATGG
TGAGAAACCTGAAGGTGGTGAATTATTTCAGCTCTCGCAACATCAAGATGCTGCACCTCTGTGC
CTTTGGCTATGGGCTCCCAGTCGTGGTGGTCATTATCTCTGCTACTGTACATCCATGGGGCTAT
GGAATGCATAATCGCTGCTGGCTGAATACGGAGACAGGATTCATTTGGAGTTTCTTGGGGCCAG
TCTGCATGATCATCACGATCAACTCTGCCCTCCTTGCCTGGACACTGTGGGTGCTGAGGCAGAA
GCTCTGCAGTGTCAACTCAGAAGTCTCTAAGCTCAAGGATACGAGGTTGCTGACCTTCAAGGCC
ATTGCCCAGATTTTCATCTTGGGTTGCTCCTGGGTGCTGGGCATTTTCCAGATTGGTCCCTTGG
CAAGCATAATGGCATACCTGTTCACCACTATCAACAGCCTTCAGGGGGCCTTCATCTTCCTCAT
TCACTGTCTGCTCAACCGCCAGGTACGAGATGAATATAGGAAACTCCTCACCAGGAAGACTGAT
CTTAGCTCCCATTCCCAGACTTCTGGGATTTTACTGTCATCTATGCCTTCCACTTCTAAGACGG
GTTAACATTTTTCTTGCTTTTAAATATATTATGGAGCAACATTTGAGGATTGTAAGTGCTTCAA
GACTACTTCGAATCATTATATAGCTTATGGAAATTTAAGGTATCGTTAGTTGGCGGCAGCTTTA
TATTTAACTCAAAACATGGATAAGTGGAACCAAACTCCAAGAGCTTCATGCACCAAGGAGAAAC
ATAAGTTACTTACTCAAATGAACTCAAATGTCTTCTGTGCCTTGCAACTATGAAGCTCCACATG
TTTTGAAAAGAGCATATCCAGTTTCAATGCCACAAGGGATTAGCATTTTTGTGTCTTCTATGTC
CTTTCTTGTGGGGTTCCAGAAATTCTCATTTAACACCTATCAAGTAGTGAGCACAGAATAGCTC
TCAATAAAGTATTTGTTGTCTGTCTGAA

hide sequence

RefSeq Acc Id:

XM_006244280 ⟹ XP_006244342

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	2,329,398 - 2,484,955 (+)	NCBI
mRatBN7.2	9	2,242,480 - 2,398,000 (+)	NCBI
Rnor_6.0	9	9,431,888 - 9,585,883 (-)	NCBI
Rnor_5.0	9	8,434,335 - 8,593,088 (-)	NCBI

Sequence:

show sequence

AGCAAGCTTTTAAAGGGAAGGCTCTCTTCACTGAATAGTTGCCACAGTATAATGTGGGGCTTTT
GGCTGCTCCTCTTCTGGGGCTTCAGTGGAACGCACAGATGGGGGATGACCACACTTGCCATCCT
GGGACAAAGACTTAACGGTGTGAATGAATGTCAAGACACTACCACTTGTCCAGCTTATGCCACC
TGCACTGACACCACGGAGAGTTATTACTGTACCTGTAAACAAGGTTTTCTGCCCAGCAATGGAC
AAACCAACTTTCAGGGCCCAGGAGTGGAATGTCAAGATGTTAATGAATGTCTTAGAAGCGACTC
GCCTTGTGGTTCTAACTCAGTCTGCACCAATATCCCAGGACGAGCCAGGTGCAGTTGTCTTAGT
GGCTTCTCTTCTTCCGCTGGTGGAAGTTGGATCCTGGGAAGTCCGGGTCATTTTCTCTGCACAG
ATGTTGACGAGTGTCTGACAATTGGGATCTGCCCTAAGAATTCTAACTGCTCTAACTCTGTGGG
GAGCTACAGCTGCACCTGCCAATCAGGCTTTGTCTCGAATGGCTCCACTTGTGAAGATGAAGAT
GAATGTGTGACTCGTAATGCTTGCCCAGAGCATGCAACCTGCCACAACACTCTTGGAAGCTATT
ATTGTACATGCAACGAAGGACTTGAATTTAGTGGAGGAGGACCAATGTTCCAGGGCCTGGAAGA
ATCTTGTGAAGATGTGGATGAGTGCTCCAGGAATTCAACGCTTTGTGGTCCCTCCTTCATTTGC
ATCAACACGCTGGGATCCTACAGCTGTTCTTGCCCAGCTGGATTCTCTTTGTCAACTTTTCAGA
TCCCTGGTCATCCAGCAGATGGGAATTGTACAGATATAGATGAGTGTGATGACATATGCCCTTC
CAACTCATCATGTACCAACACCCTTGGGAGCTACTTCTGCACTTGCCACCCTGGCTTTGCCTCA
AGCAATGGACAGCTGAATTTCACAGACCAAGAAGTGACATGTGAAGATATTGATGAGTGCACTC
AAGATCCATTTCGATGTGGACGAAATTCTTCCTGCACCAATGTACCAGGTTCCTACAACTGCAG
CTGTCTTCCCGACTTTCGAATGGATCCAGGAGGCTCCCAAGCACATGGAAACTTCACATGCAAA
AGGATTCCCTTCAAGTGTAAGGAAGACTTGATACCCAAAAGTGAGCAGATAGAGCAGTGCCAAG
CAGGGCAAGGCCGGAATCTTGATTATACTTCCTTCTGCACATTTGTGAATGCCACCTTTACCAT
CCTGGATAACACCTGTGAAAACAAAAGTGCTCCAGTGTCCTTACAGAGTGCAGCTACAAGTGTC
TCCCTCATGCTGGAGCAAGCATCGACCTGGTTTGAGTTCAGCAGGGAAGAGACATCTACTCTGG
GCACTATCTTGCTGGAGACTGTGGAAAGCACCATGTTGGCTGCTCTTCTGACACCCTCTGGGAA
TGCCAGTCAGACCATTCGGACGGAGTACTTGGAAATTGAAAGCAAAGTCATCAATGAAGAATGC
AATGAGGAGAATGTGTCCATTAACTTGAAAGCCAGAGGGGACAAGATGGATGTTGGCTGTTTCA
TAATCAAAGAATCAGAATCTACAGGGACCCCAGGAGTGGCTTTTGTCTCCTTTGCACACATGGA
CTCAGTTTTAGATGAGCGCTTCTTTGAAGATGGTCAGGCCTCCTGGAAACTGAGGATGAATTCC
CATGTTGTTGGTGGCACTGTAACCGGGGAGAGGAAGGAGGACTTCTCCAAGCCTATCGTCTATA
CCCTCCAGCACATCCAGCCAAAGCAGAAGTCTGAGAGGTCTATATGTGTCTCCTGGAACACCGA
TGTGGAGGATGGGAGATGGACACCCTCGGGCTGTGAGACTGTAGAAGCATCTGAGACACACACA
GTCTGCAGCTGTAACCGGATGACAAATTTGGCCATCATCATGGCTTCTGGGGAGCTTACAACAG
CTTGCGCTATCATTGCGGGATTTCTACACTATCTTTTCCTTGCCTGCTTCTTCTGGATGCTGGT
GGAGGCAGTGATGCTCTTCCTGATGGTGAGAAACCTGAAGGTGGTGAATTATTTCAGCTCTCGC
AACATCAAGATGCTGCACCTCTGTGCCTTTGGCTATGGGCTCCCAGTCGTGGTGGTCATTATCT
CTGCTACTGTACATCCATGGGGCTATGGAATGCATAATCGCTGCTGGCTGAATACGGAGACAGG
ATTCATTTGGAGTTTCTTGGGGCCAGTCTGCATGATCATCACGATCAACTCTGCCCTCCTTGCC
TGGACACTGTGGGTGCTGAGGCAGAAGCTCTGCAGTGTCAACTCAGAAGTCTCTAAGCTCAAGG
ATACGAGGTTGCTGACCTTCAAGGCCATTGCCCAGATTTTCATCTTGGGTTGCTCCTGGGTGCT
GGGCATTTTCCAGATTGGTCCCTTGGCAAGCATAATGGCATACCTGTTCACCACTATCAACAGC
CTTCAGGGGGCCTTCATCTTCCTCATTCACTGTCTGCTCAACCGCCAGGTACGAGATGAATATA
GGAAACTCCTCACCAGGAAGACTGATCTTAGCTCCCATTCCCAGACTTCTGGGATTTTACTGTC
ATCTATGCCTTCCACTTCTAAGACGGGTTAACATTTTTCCTTGCTTTTAAATATATTATGGAGC
AACATTTGAGGATTGTAAGTGCTTCAAGACTACTTCGAATCATTATATAGCTTATGGAAATTTA
AGGTATCGTTAGTTGGCGGCAGCTTTATATTTAACTCAAAACATGGATAAGTGGAACCAAACTC
CAAGAGCTTCATGCACCAAGGAGAAACATAAGTTACTTACTCAAATGAACTCAAATGTCTTCTG
TGCCTTGCAACTATGAAGCTCCACATGTTTTGAAAAGAGCATATCCAGTTTCAATGCCACAAGG
GATTAGCATTTTTGTGTCTTCTATGTCCTTTCTTGTGGGGTTCCAGAAATTCTCATTTAACACC
TATCAAGTAGTGAGCACAGAATAGCTCTCAATAAAGTATTTGTTGTCTGTCTGAA

hide sequence

RefSeq Acc Id:

XM_039083467 ⟹ XP_038939395

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	2,329,437 - 2,484,955 (+)	NCBI
mRatBN7.2	9	2,242,481 - 2,398,000 (+)	NCBI

RefSeq Acc Id:

XM_039083468 ⟹ XP_038939396

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	2,329,398 - 2,468,451 (+)	NCBI
mRatBN7.2	9	2,242,481 - 2,371,576 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001007558	(Get FASTA)	NCBI Sequence Viewer
	XP_006244342	(Get FASTA)	NCBI Sequence Viewer
	XP_038939395	(Get FASTA)	NCBI Sequence Viewer
	XP_038939396	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAU95564	(Get FASTA)	NCBI Sequence Viewer
	EDL83560	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067220
	ENSRNOP00000067220.1
	ENSRNOP00000084080
	ENSRNOP00000106082
GenBank Protein	Q5Y4N8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001007558 ⟸ NM_001007557
- Peptide Label:	precursor
- UniProtKB:	Q5Y4N8 (UniProtKB/Swiss-Prot), A6KQQ5 (UniProtKB/TrEMBL), A0A8I5ZPM3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWGFWLLLFWGFSGTHRWGMTTLAILGQRLNGVNECQDTTTCPAYATCTDTTESYYCTCKQGFL PSNGQTNFQGPGVECQDVNECLRSDSPCGSNSVCTNIPGRARCSCLSGFSSSAGGSWILGSPGH FLCTDVDECLTIGICPKNSNCSNSVGSYSCTCQSGFVSNGSTCEDEDECVTRNACPEHATCHNT LGSYYCTCNEGLEFSGGGPMFQGLEESCEDVDECSRNSTLCGPSFICINTLGSYSCSCPAGFSL STFQIPGHPADGNCTDIDECDDICPSNSSCTNTLGSYFCTCHPGFASSNGQLNFTDQEVTCEDI DECTQDPFRCGRNSSCTNVPGSYNCSCLPDFRMDPGGSQAHGNFTCKRIPFKCKEDLIPKSEQI EQCQAGQGRNLDYTSFCTFVNATFTILDNTCENKSAPVSLQSAATSVSLMLEQASTWFEFSREE TSTLGTILLETVESTMLAALLTPSGNASQTIRTEYLEIESKVINEECNEENVSINLKARGDKMD VGCFIIKESESTGTPGVAFVSFAHMDSVLDERFFEDGQASWKLRMNSHVVGGTVTGERKEDFSK PIVYTLQHIQPKQKSERSICVSWNTDVEDGRWTPSGCETVEASETHTVCSCNRMTNLAIIMASG ELTMEFSLYIISYVGTVISLVCLALAIATFLLFRAVQNHNTYLHLHLCVCLFLAKILFLTGIDK TDNQTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPV VVVIISATVHPWGYGMHNRCWLNTETGFIWSFLGPVCMIITINSALLAWTLWVLRQKLCSVNSE VSKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTTINSLQGAFIFLIHCLLNRQ VRDEYRKLLTRKTDLSSHSQTSGILLSSMPSTSKTG hide sequence

RefSeq Acc Id:	XP_006244342 ⟸ XM_006244280
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZYF2 (UniProtKB/TrEMBL), A0A8I5ZPM3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWGFWLLLFWGFSGTHRWGMTTLAILGQRLNGVNECQDTTTCPAYATCTDTTESYYCTCKQGFL PSNGQTNFQGPGVECQDVNECLRSDSPCGSNSVCTNIPGRARCSCLSGFSSSAGGSWILGSPGH FLCTDVDECLTIGICPKNSNCSNSVGSYSCTCQSGFVSNGSTCEDEDECVTRNACPEHATCHNT LGSYYCTCNEGLEFSGGGPMFQGLEESCEDVDECSRNSTLCGPSFICINTLGSYSCSCPAGFSL STFQIPGHPADGNCTDIDECDDICPSNSSCTNTLGSYFCTCHPGFASSNGQLNFTDQEVTCEDI DECTQDPFRCGRNSSCTNVPGSYNCSCLPDFRMDPGGSQAHGNFTCKRIPFKCKEDLIPKSEQI EQCQAGQGRNLDYTSFCTFVNATFTILDNTCENKSAPVSLQSAATSVSLMLEQASTWFEFSREE TSTLGTILLETVESTMLAALLTPSGNASQTIRTEYLEIESKVINEECNEENVSINLKARGDKMD VGCFIIKESESTGTPGVAFVSFAHMDSVLDERFFEDGQASWKLRMNSHVVGGTVTGERKEDFSK PIVYTLQHIQPKQKSERSICVSWNTDVEDGRWTPSGCETVEASETHTVCSCNRMTNLAIIMASG ELTTACAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHLCAFGYGLPVV VVIISATVHPWGYGMHNRCWLNTETGFIWSFLGPVCMIITINSALLAWTLWVLRQKLCSVNSEV SKLKDTRLLTFKAIAQIFILGCSWVLGIFQIGPLASIMAYLFTTINSLQGAFIFLIHCLLNRQV RDEYRKLLTRKTDLSSHSQTSGILLSSMPSTSKTG hide sequence

Ensembl Acc Id:

ENSRNOP00000067220 ⟸ ENSRNOT00000073926

RefSeq Acc Id:	XP_038939395 ⟸ XM_039083467
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZPM3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038939396 ⟸ XM_039083468
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000080360 ⟸ ENSRNOT00000107295

Ensembl Acc Id:

ENSRNOP00000084080 ⟸ ENSRNOT00000105310

Protein Domains

EGF-like G-protein coupled receptors family 2 profile GAIN-B

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5Y4N8-F1-model_v2	AlphaFold	Q5Y4N8	1-932	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696431

Promoter ID:

EPDNEW_R6955

Type:

multiple initiation site

Name:

Adgre1_1

Description:

adhesion G protein-coupled receptor E1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	9,585,843 - 9,585,903	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359214	AgrOrtholog
BioCyc Gene	G2FUF-28478	BioCyc
Ensembl Genes	ENSRNOG00000046254	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073926	ENTREZGENE
	ENSRNOT00000073926.3	UniProtKB/Swiss-Prot
	ENSRNOT00000105310	ENTREZGENE
	ENSRNOT00000156968	ENTREZGENE
Gene3D-CATH	2.60.220.50	UniProtKB/Swiss-Prot
	Laminin	UniProtKB/Swiss-Prot
	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	EGF-like_Ca-bd_dom	UniProtKB/Swiss-Prot
	EGF-like_dom	UniProtKB/Swiss-Prot
	EGF-type_Asp/Asn_hydroxyl_site	UniProtKB/Swiss-Prot
	EGF_Ca-bd_CS	UniProtKB/Swiss-Prot
	GAIN_dom_N	UniProtKB/Swiss-Prot
	GAIN_dom_sf	UniProtKB/Swiss-Prot
	GPCR_2-like	UniProtKB/Swiss-Prot
	GPCR_2_EMR1-like_rcpt	UniProtKB/Swiss-Prot
	GPCR_2_secretin-like	UniProtKB/Swiss-Prot
	GPCR_2_secretin-like_CS	UniProtKB/Swiss-Prot
	GPS	UniProtKB/Swiss-Prot
	Growth_fac_rcpt_cys_sf	UniProtKB/Swiss-Prot
	NOTCH1_EGF-like	UniProtKB/Swiss-Prot
KEGG Report	rno:316137	UniProtKB/Swiss-Prot
NCBI Gene	316137	ENTREZGENE
PANTHER	ADHESION G PROTEIN-COUPLED RECEPTOR E1	UniProtKB/Swiss-Prot
	ADHESION G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_2	UniProtKB/Swiss-Prot
	EGF_CA	UniProtKB/Swiss-Prot
	GAIN	UniProtKB/Swiss-Prot
	GPS	UniProtKB/Swiss-Prot
PhenoGen	Adgre1	PhenoGen
PRINTS	EMR1HORMONER	UniProtKB/Swiss-Prot
	GPCRSECRETIN	UniProtKB/Swiss-Prot
PROSITE	ASX_HYDROXYL	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
	EGF_CA	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F2_2	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F2_4	UniProtKB/Swiss-Prot
	GPS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000046254	RatGTEx
SMART	EGF	UniProtKB/Swiss-Prot
	EGF_CA	UniProtKB/Swiss-Prot
	GPS	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
	SSF57184	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZPM3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYF2	ENTREZGENE, UniProtKB/TrEMBL
	A6KQQ5	ENTREZGENE, UniProtKB/TrEMBL
	AGRE1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-03-16	Adgre1	adhesion G protein-coupled receptor E1	Emr1	EGF-like module containing, mucin-like, hormone receptor-like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-25	Emr1	EGF-like module containing, mucin-like, hormone receptor-like 1	Emr1	EGF-like module containing, mucin-like, hormone receptor-like sequence 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Emr1	EGF-like module containing, mucin-like, hormone receptor-like sequence 1			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Emr1	EGF-like module containing, mucin-like, hormone receptor-like sequence 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD