Symbol:
POLR1H
Name:
RNA polymerase I subunit H
RGD ID:
1351679
HGNC Page
HGNC:13182
Description:
Predicted to enable DNA-directed RNA polymerase activity; nucleic acid binding activity; and zinc ion binding activity. Predicted to be involved in termination of RNA polymerase I transcription. Part of RNA polymerase I complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
A12.2; DNA-directed RNA polymerase I subunit H; DNA-directed RNA polymerase I subunit RPA12; HTEX-6; HTEX6; hZR14; MGC13376; RNA polymerase I small specific subunit Rpa12; Rpa12; tctex-6; TCTEX6; TEX6; transcription-associated zinc ribbon protein; zinc ribbon domain containing 1; zinc ribbon domain containing, 1; zinc ribbon domain-containing protein 1; ZNRD1; ZR14
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Polr1h (RNA polymerase I subunit H) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Polr1h (RNA polymerase I subunit H) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Polr1h (RNA polymerase I subunit H) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
POLR1H (RNA polymerase I subunit H) NCBI
Ortholog
Canis lupus familiaris (dog):
POLR1H (RNA polymerase I subunit H) HGNC
HomoloGene, NCBI
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Polr1h (RNA polymerase I subunit H) NCBI
Ortholog
Sus scrofa (pig):
POLR1H (RNA polymerase I subunit H) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Treefam
Chlorocebus sabaeus (green monkey):
POLR1H (RNA polymerase I subunit H) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Polr1h (RNA polymerase I subunit H) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Cxxc5l1 (CXXC finger protein 5 like 1) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Polr1h (RNA polymerase I subunit H)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Polr1h (RNA polymerase I subunit H)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
znrd1 (zinc ribbon domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
rpoa-12
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPA12
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpI12
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
polr1h
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,060,062 - 30,064,907 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,058,899 - 30,064,909 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,029,042 - 30,032,684 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,137,015 - 30,140,665 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 30,137,014 - 30,140,664 NCBI Celera 6 31,627,294 - 31,630,939 (+) NCBI Celera Cytogenetic Map 6 p22.1 NCBI HuRef 6 29,827,192 - 29,830,858 (+) NCBI HuRef CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
POLR1H Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1332448 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLR1H mRNA CTD PMID:22206623 POLR1H Human 1,2-dimethylhydrazine decreases expression ISO RGD:1332448 6480464 1,2-Dimethylhydrazine results in decreased expression of POLR1H mRNA CTD PMID:22206623 POLR1H Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1332448 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR1H mRNA CTD PMID:17942748 POLR1H Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1332448 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of POLR1H mRNA CTD PMID:30294300 POLR1H Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1303114 6480464 Tetrachlorodibenzodioxin results in decreased expression of POLR1H mRNA CTD PMID:21215274 POLR1H Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1303114 6480464 Tetrachlorodibenzodioxin affects the expression of POLR1H mRNA CTD PMID:32109520 POLR1H Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1332448 6480464 Tetrachlorodibenzodioxin affects the expression of POLR1H mRNA CTD PMID:21570461 POLR1H Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1332448 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR1H mRNA; [TIPARP gene mutant more ... CTD PMID:17942748|PMID:25975270 POLR1H Human 2,4-dinitrotoluene affects expression ISO RGD:1303114 6480464 2,4-dinitrotoluene affects the expression of POLR1H mRNA CTD PMID:21346803 POLR1H Human 2,6-dinitrotoluene affects expression ISO RGD:1303114 6480464 2,6-dinitrotoluene affects the expression of POLR1H mRNA CTD PMID:21346803 POLR1H Human 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions EXP 6480464 Verapamil inhibits the reaction [POLR1H protein results in decreased susceptibility to Doxorubicin]; Verapamil inhibits the more ... CTD PMID:14726695 POLR1H Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of POLR1H mRNA CTD PMID:30851411 POLR1H Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of POLR1H mRNA CTD PMID:21179406 POLR1H Human 4,4'-diaminodiphenylmethane affects expression ISO RGD:1332448 6480464 4,4'-diaminodiphenylmethane affects the expression of POLR1H mRNA CTD PMID:18648102 POLR1H Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:1332448 6480464 bisphenol S results in decreased expression of POLR1H mRNA CTD PMID:39298647 POLR1H Human 4-phenylbutyric acid decreases expression EXP 6480464 4-phenylbutyric acid results in decreased expression of POLR1H mRNA CTD PMID:14583596 POLR1H Human aflatoxin B1 increases expression ISO RGD:1332448 6480464 Aflatoxin B1 results in increased expression of POLR1H mRNA CTD PMID:19770486 POLR1H Human alpha-Zearalanol multiple interactions ISO RGD:1303114 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ZNRD1 mRNA CTD PMID:35163327 POLR1H Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of POLR1H mRNA CTD PMID:24449571 POLR1H Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to POLR1H mRNA] CTD PMID:32406909 POLR1H Human benzo[a]pyrene increases expression ISO RGD:1332448 6480464 Benzo(a)pyrene results in increased expression of POLR1H mRNA CTD PMID:22228805 POLR1H Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of POLR1H promoter CTD PMID:27901495 POLR1H Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of POLR1H mRNA CTD PMID:20382639 POLR1H Human bisphenol A increases expression ISO RGD:1303114 6480464 bisphenol A results in increased expression of POLR1H mRNA CTD PMID:25181051 POLR1H Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of POLR1H mRNA CTD PMID:30903817 POLR1H Human bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of POLR1H gene CTD PMID:31601247 POLR1H Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of POLR1H more ... CTD PMID:35301059 POLR1H Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ZNRD1 mRNA CTD PMID:38568856 POLR1H Human cadmium dichloride decreases expression ISO RGD:1303114 6480464 Cadmium Chloride results in decreased expression of POLR1H mRNA CTD PMID:33453195 POLR1H Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of POLR1H more ... CTD PMID:35301059 POLR1H Human cadmium sulfate decreases expression ISO RGD:1332448 6480464 cadmium sulfate results in decreased expression of POLR1H mRNA CTD PMID:19274763 POLR1H Human calyculin A decreases expression ISO RGD:1332448 6480464 calyculin A results in decreased expression of POLR1H mRNA CTD PMID:25270620 POLR1H Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to POLR1H gene] CTD PMID:28238834 POLR1H Human chlorpyrifos increases expression ISO RGD:1332448 6480464 Chlorpyrifos results in increased expression of POLR1H mRNA CTD PMID:37019170 POLR1H Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of POLR1H mRNA CTD PMID:19549813 POLR1H Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of POLR1H mRNA CTD PMID:19167446 POLR1H Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of POLR1H mRNA CTD PMID:27989131 POLR1H Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ZNRD1 mRNA CTD PMID:37042841 POLR1H Human dibutyl phthalate decreases expression ISO RGD:1332448 6480464 Dibutyl Phthalate results in decreased expression of POLR1H mRNA CTD PMID:17361019 POLR1H Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of POLR1H mRNA CTD PMID:28302478 POLR1H Human doxorubicin multiple interactions EXP 6480464 Verapamil inhibits the reaction [POLR1H protein results in decreased susceptibility to Doxorubicin]; Verapamil inhibits the more ... CTD PMID:14726695 POLR1H Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of POLR1H mRNA CTD PMID:29803840 POLR1H Human doxorubicin decreases response to substance EXP 6480464 POLR1H protein results in decreased susceptibility to Doxorubicin CTD PMID:14726695|PMID:16609701 POLR1H Human doxorubicin increases secretion EXP 6480464 POLR1H protein results in increased secretion of Doxorubicin CTD PMID:14726695 POLR1H Human ethanol increases expression ISO RGD:1332448 6480464 Ethanol results in increased expression of POLR1H mRNA CTD PMID:30319688 POLR1H Human etoposide decreases response to substance EXP 6480464 POLR1H protein results in decreased susceptibility to Etoposide CTD PMID:14726695 POLR1H Human etoposide multiple interactions EXP 6480464 Verapamil inhibits the reaction [POLR1H protein results in decreased susceptibility to Etoposide] CTD PMID:14726695 POLR1H Human flutamide increases expression ISO RGD:1303114 6480464 Flutamide results in increased expression of POLR1H mRNA CTD PMID:24793618 POLR1H Human folic acid multiple interactions ISO RGD:1332448 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLR1H mRNA CTD PMID:22206623 POLR1H Human folpet decreases expression ISO RGD:1332448 6480464 folpet results in decreased expression of POLR1H mRNA CTD PMID:31558096 POLR1H Human fulvestrant multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of POLR1H gene CTD PMID:31601247 POLR1H Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of POLR1H mRNA CTD PMID:21179406 POLR1H Human lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of ZNRD1 mRNA CTD PMID:38568856 POLR1H Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human methotrexate decreases response to substance EXP 6480464 POLR1H protein results in decreased susceptibility to Methotrexate CTD PMID:16609701 POLR1H Human nitrates multiple interactions ISO RGD:1332448 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of POLR1H more ... CTD PMID:35964746 POLR1H Human paracetamol affects expression ISO RGD:1332448 6480464 Acetaminophen affects the expression of POLR1H mRNA CTD PMID:17562736 POLR1H Human paracetamol decreases expression ISO RGD:1303114 6480464 Acetaminophen results in decreased expression of POLR1H mRNA CTD PMID:33387578 POLR1H Human perfluorooctanoic acid multiple interactions ISO RGD:1303114 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ZNRD1 mRNA CTD PMID:35163327 POLR1H Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of POLR1H mRNA CTD PMID:19159669 POLR1H Human propiconazole increases expression ISO RGD:1332448 6480464 propiconazole results in increased expression of POLR1H mRNA CTD PMID:21278054 POLR1H Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of POLR1H mRNA CTD PMID:21632981 POLR1H Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of POLR1H mRNA CTD PMID:30851411 POLR1H Human resveratrol decreases expression ISO RGD:1332448 6480464 Resveratrol results in decreased expression of POLR1H protein CTD PMID:25505154 POLR1H Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of POLR1H mRNA; [Plant Extracts co-treated more ... CTD PMID:23557933 POLR1H Human sirolimus multiple interactions EXP 6480464 Sirolimus inhibits the reaction [TP73 protein results in increased expression of POLR1H mRNA] CTD PMID:21245298 POLR1H Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 POLR1H Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of POLR1H mRNA CTD PMID:31533062 POLR1H Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of POLR1H mRNA CTD PMID:31758290 POLR1H Human tetrachloromethane increases expression ISO RGD:1303114 6480464 Carbon Tetrachloride results in increased expression of POLR1H mRNA CTD PMID:31150632 POLR1H Human tetrachloromethane increases expression ISO RGD:1332448 6480464 Carbon Tetrachloride results in increased expression of POLR1H mRNA CTD PMID:31919559 POLR1H Human tolcapone decreases expression ISO RGD:1303114 6480464 Tolcapone results in decreased expression of POLR1H mRNA CTD PMID:24136188 POLR1H Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of POLR1H mRNA CTD PMID:25979313 POLR1H Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of POLR1H mRNA CTD PMID:23179753|PMID:27188386|PMID:28001369 POLR1H Human verapamil multiple interactions EXP 6480464 Verapamil inhibits the reaction [POLR1H protein results in decreased susceptibility to Doxorubicin]; Verapamil inhibits the more ... CTD PMID:14726695 POLR1H Human vinclozolin decreases expression ISO RGD:1303114 6480464 vinclozolin results in decreased expression of POLR1H mRNA CTD PMID:23869203 POLR1H Human vincristine decreases response to substance EXP 6480464 POLR1H protein results in decreased susceptibility to Vincristine CTD PMID:14726695 POLR1H Human vincristine multiple interactions EXP 6480464 Verapamil inhibits the reaction [POLR1H protein results in decreased susceptibility to Vincristine] CTD PMID:14726695 POLR1H Human XL147 multiple interactions ISO RGD:1332448 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of POLR1H mRNA] CTD PMID:29891994
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP) 2-hydroxypropanoic acid (EXP) 2-methylcholine (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (ISO) antirheumatic drug (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (EXP) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) calyculin A (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) copper(II) sulfate (EXP) coumestrol (EXP) cyclosporin A (EXP) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dicrotophos (EXP) doxorubicin (EXP) ethanol (ISO) etoposide (EXP) flutamide (ISO) folic acid (ISO) folpet (ISO) fulvestrant (EXP) hydrogen peroxide (EXP) lead diacetate (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) methotrexate (EXP) nitrates (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) propiconazole (ISO) quercetin (EXP) rac-lactic acid (EXP) resveratrol (EXP,ISO) sirolimus (EXP) sodium arsenite (EXP) sunitinib (EXP) temozolomide (EXP) tetrachloromethane (ISO) tolcapone (ISO) valproic acid (EXP) verapamil (EXP) vinclozolin (ISO) vincristine (EXP) XL147 (ISO)
POLR1H Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,060,062 - 30,064,907 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,058,899 - 30,064,909 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,029,042 - 30,032,684 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,137,015 - 30,140,665 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 30,137,014 - 30,140,664 NCBI Celera 6 31,627,294 - 31,630,939 (+) NCBI Celera Cytogenetic Map 6 p22.1 NCBI HuRef 6 29,827,192 - 29,830,858 (+) NCBI HuRef CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI T2T-CHM13v2.0
Polr1h Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 37,265,250 - 37,269,417 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 37,265,248 - 37,269,451 (-) Ensembl GRCm39 Ensembl GRCm38 17 36,954,358 - 36,958,525 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 36,954,356 - 36,958,559 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 37,091,303 - 37,095,373 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 36,562,411 - 36,566,481 (-) NCBI MGSCv36 mm8 Celera 17 40,377,895 - 40,381,965 (-) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 19.16 NCBI
Polr1h Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 1,600,170 - 1,604,088 (+) NCBI GRCr8 mRatBN7.2 20 1,594,936 - 1,598,854 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 1,594,936 - 1,598,854 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 1,647,698 - 1,651,624 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 1,651,195 - 1,655,121 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 1,592,702 - 1,596,588 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 2,088,518 - 2,092,436 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 2,088,533 - 2,092,436 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 4,125,232 - 4,129,150 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 1,687,673 - 1,691,591 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 1,687,849 - 1,691,468 (+) NCBI Celera 20 2,303,510 - 2,307,419 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
Polr1h Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955583 191,564 - 195,358 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955583 191,252 - 195,563 (+) NCBI ChiLan1.0 ChiLan1.0
POLR1H Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 44,654,673 - 44,658,296 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 40,617,667 - 40,621,308 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 29,839,067 - 29,842,692 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 30,509,326 - 30,512,956 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 30,509,326 - 30,512,956 (+) Ensembl panpan1.1 panPan2
POLR1H Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 26,285,520 - 26,288,550 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 26,285,538 - 26,288,534 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 35 26,594,054 - 26,597,115 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 35 26,248,647 - 26,251,702 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 26,309,259 - 26,312,356 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 27,779,521 - 27,782,596 (+) NCBI UU_Cfam_GSD_1.0
Polr1h
POLR1H Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 22,626,846 - 22,631,555 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 22,626,871 - 22,631,557 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 25,156,351 - 25,161,054 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POLR1H Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 42,434,992 - 42,438,993 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 42,435,196 - 42,438,981 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 29,716,158 - 29,720,178 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Polr1h
.
Predicted Target Of
Count of predictions: 823 Count of miRNA genes: 214 Interacting mature miRNAs: 219 Transcripts: ENST00000332435, ENST00000359374, ENST00000376782, ENST00000376785, ENST00000463141, ENST00000471008 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 596989777 GWAS1109296_H hemoglobin measurement QTL GWAS1109296 (human) 5e-28 hemoglobin measurement 6 30060083 30060084 Human 1643377 BW325_H Body weight QTL 325 (human) 2.32 0.0005 Body fat amount 6 6911960 32911960 Human 1643569 GLUCO21_H Glucose level QTL 21 (human) 0.021 Glucose level non-insulin-dependent 6 6911960 32911960 Human 1298458 BW9_H Body weight QTL 9 (human) 2.7 0.0002 Body fat amount 6 6911960 32911960 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 1358854 MULTSCL4_H Multiple sclerosis susceptibility QTL 4 (human) Multiple sclerosis susceptibility 6 6911960 32911960 Human 596968966 GWAS1088485_H rheumatoid arthritis, multiple sclerosis QTL GWAS1088485 (human) 4e-10 rheumatoid arthritis, multiple sclerosis 6 30062337 30062338 Human 596964135 GWAS1083654_H attention deficit hyperactivity disorder, bipolar disorder, autism spectrum disorder, schizophrenia, major depressive disorder QTL GWAS1083654 (human) 8e-09 attention deficit hyperactivity disorder, bipolar disorder, autism spectrum disorder, schizophrenia, major depressive disorder 6 30064745 30064746 Human 407015476 GWAS664452_H attention deficit hyperactivity disorder, unipolar depression, bipolar disorder, autism spectrum disorder, schizophrenia QTL GWAS664452 (human) 8e-09 attention deficit hyperactivity disorder, unipolar depression, bipolar disorder, autism spectrum disorder, schizophrenia 6 30064745 30064746 Human 406905591 GWAS554567_H blood protein measurement QTL GWAS554567 (human) 2e-20 blood protein measurement 6 30060083 30060084 Human 407001781 GWAS650757_H hemoglobin measurement QTL GWAS650757 (human) 5e-28 hemoglobin measurement 6 30060083 30060084 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 1643399 BMD5_H Bone mineral density QTL 5 (human) 2.32 0.0005 Bone mineral density 6 6911960 32911960 Human 596949962 GWAS1069481_H blood protein measurement QTL GWAS1069481 (human) 2e-20 blood protein measurement 6 30060083 30060084 Human
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4973
1726
2351
6
624
1951
465
2269
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000332435 ⟹ ENSP00000331111
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,061,265 - 30,064,907 (+) Ensembl
Ensembl Acc Id:
ENST00000359374 ⟹ ENSP00000352333
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,061,259 - 30,064,909 (+) Ensembl
Ensembl Acc Id:
ENST00000376782 ⟹ ENSP00000365978
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,061,257 - 30,064,909 (+) Ensembl
Ensembl Acc Id:
ENST00000376785 ⟹ ENSP00000365981
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,061,263 - 30,064,909 (+) Ensembl
Ensembl Acc Id:
ENST00000463141
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,061,330 - 30,064,909 (+) Ensembl
Ensembl Acc Id:
ENST00000471008
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 30,058,899 - 30,064,909 (+) Ensembl
RefSeq Acc Id:
NM_001278785 ⟹ NP_001265714
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,064,907 (+) NCBI GRCh37 6 30,029,017 - 30,032,686 (+) NCBI HuRef 6 29,827,192 - 29,830,858 (+) NCBI CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI
Sequence:
AGAGCTGGCGCTCTAGCCCACGGAGTTGGTTAACTCCTCTCACCGGCCCCTGGAAAGGGTTCCAAGTCCTTTAGTACCCGACGCTGTCTGGGAATTCCGGGCGTTTCGGCTCCTTGGTCGCAGAGACC
hide sequence
RefSeq Acc Id:
NM_001278786 ⟹ NP_001265715
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,064,907 (+) NCBI GRCh37 6 30,029,017 - 30,032,686 (+) NCBI HuRef 6 29,827,192 - 29,830,858 (+) NCBI CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI
Sequence:
AGAGCTGGCGCTCTAGCCCACGGAGTTGGTTAACTCCTCTCACCGGCCCCTGGAAAGGGTTCCAAGTCCTTTAGTACCCGACGCTGTCTGGGAATTCCGGGCGTTTCGGCTCCTTGGTCGCAGAGGCA
hide sequence
RefSeq Acc Id:
NM_014596 ⟹ NP_055411
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,064,907 (+) NCBI GRCh37 6 30,029,017 - 30,032,686 (+) NCBI Build 36 6 30,137,015 - 30,140,665 (+) NCBI Archive HuRef 6 29,827,192 - 29,830,858 (+) NCBI CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI
Sequence:
AGAGCTGGCGCTCTAGCCCACGGAGTTGGTTAACTCCTCTCACCGGCCCCTGGAAAGGGTTCCAAGTCCTTTAGTACCCGACGCTGTCTGGGAATTCCGGGCGTTTCGGCTCCTTGGTCGCAGAGGCA
hide sequence
RefSeq Acc Id:
NM_170783 ⟹ NP_740753
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,064,907 (+) NCBI GRCh37 6 30,029,017 - 30,032,686 (+) NCBI Build 36 6 30,137,015 - 30,140,665 (+) NCBI Archive HuRef 6 29,827,192 - 29,830,858 (+) NCBI CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI
Sequence:
AGAGCTGGCGCTCTAGCCCACGGAGTTGGTTAACTCCTCTCACCGGCCCCTGGAAAGGGTTCCAAGTCCTTTAGTACCCGACGCTGTCTGGGAATTCCGGGCGTTTCGGCTCCTTGGTCGCAGAGGCA
hide sequence
RefSeq Acc Id:
NR_103864
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,064,907 (+) NCBI GRCh37 6 30,029,017 - 30,032,686 (+) NCBI HuRef 6 29,827,192 - 29,830,858 (+) NCBI CHM1_1 6 30,031,066 - 30,034,735 (+) NCBI T2T-CHM13v2.0 6 29,925,545 - 29,929,181 (+) NCBI
Sequence:
AGAGCTGGCGCTCTAGCCCACGGAGTTGGTTAACTCCTCTCACCGGCCCCTGGAAAGGGTTCCAAGTCCTTTAGTACCCGACGCTGTCTGGGAATTCCGGGCGTTTCGGCTCCTTGGTCGCAGAGGCA
hide sequence
RefSeq Acc Id:
XM_047418695 ⟹ XP_047274651
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 30,060,062 - 30,064,907 (+) NCBI
RefSeq Acc Id:
NP_740753 ⟸ NM_170783
- UniProtKB:
Q9P1U0 (UniProtKB/Swiss-Prot), Q2L6J2 (UniProtKB/TrEMBL), A0A1U9X8Y8 (UniProtKB/TrEMBL)
- Sequence:
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
hide sequence
RefSeq Acc Id:
NP_055411 ⟸ NM_014596
- UniProtKB:
Q9P1U0 (UniProtKB/Swiss-Prot), Q2L6J2 (UniProtKB/TrEMBL), A0A1U9X8Y8 (UniProtKB/TrEMBL)
- Sequence:
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
hide sequence
RefSeq Acc Id:
NP_001265715 ⟸ NM_001278786
- UniProtKB:
Q9P1U0 (UniProtKB/Swiss-Prot), Q2L6J2 (UniProtKB/TrEMBL), A0A1U9X8Y8 (UniProtKB/TrEMBL)
- Sequence:
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
hide sequence
RefSeq Acc Id:
NP_001265714 ⟸ NM_001278785
- UniProtKB:
Q9P1U0 (UniProtKB/Swiss-Prot), Q2L6J2 (UniProtKB/TrEMBL), A0A1U9X8Y8 (UniProtKB/TrEMBL)
- Sequence:
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
hide sequence
Ensembl Acc Id:
ENSP00000352333 ⟸ ENST00000359374
Ensembl Acc Id:
ENSP00000331111 ⟸ ENST00000332435
Ensembl Acc Id:
ENSP00000365978 ⟸ ENST00000376782
Ensembl Acc Id:
ENSP00000365981 ⟸ ENST00000376785
RefSeq Acc Id:
XP_047274651 ⟸ XM_047418695
- Peptide Label:
isoform X1
- UniProtKB:
Q9P1U0 (UniProtKB/Swiss-Prot), A0A1U9X8Y8 (UniProtKB/TrEMBL), Q2L6J2 (UniProtKB/TrEMBL)
RGD ID: 6872350 Promoter ID: EPDNEW_H9339 Type: initiation region Name: ZNRD1_1 Description: zinc ribbon domain containing 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 30,061,265 - 30,061,325 EPDNEW
RGD ID: 6803994 Promoter ID: HG_KWN:52792 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, Jurkat, K562, Lymphoblastoid Transcripts: ENST00000376782, ENST00000376785, NM_014596, OTTHUMT00000076272, OTTHUMT00000076273, OTTHUMT00000076274 Position: Human Assembly Chr Position (strand) Source Build 36 6 30,137,526 - 30,138,026 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2020-04-20
POLR1H
RNA polymerase I subunit H
ZNRD1
zinc ribbon domain containing 1
Symbol and/or name change
19259463 PROVISIONAL
