Symbol:
DYNLT3
Name:
dynein light chain Tctex-type 3
RGD ID:
1350586
HGNC Page
HGNC:11694
Description:
Enables identical protein binding activity. Predicted to be involved in microtubule-based movement and regulation of mitotic cell cycle. Located in kinetochore. Part of cytoplasmic dynein complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
dynein, light chain, Tctex-type 3; protein 91/23; RP3; t-complex-associated-testis-expressed 1-like; TCTE1L; TCTEX1L
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Dynlt3 (dynein light chain Tctex-type 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dynlt3 (dynein light chain Tctex-type 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Dynlt3 (dynein light chain Tctex-type 3) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
DYNLT3 (dynein light chain Tctex-type 3) NCBI
Ortholog
Canis lupus familiaris (dog):
DYNLT3 (dynein light chain Tctex-type 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dynlt3 (dynein light chain Tctex-type 3) NCBI
Ortholog
Sus scrofa (pig):
DYNLT3 (dynein light chain Tctex-type 3) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
DYNLT3 (dynein light chain Tctex-type 3) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Dynlt3 (dynein light chain Tctex-type 3) NCBI
Ortholog
Other homologs 2
Sus scrofa (pig):
DYNLT1 (dynein light chain Tctex-type 1) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dynlt3 (dynein light chain Tctex-type 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Dynlt3 (dynein light chain Tctex-type 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
dynlt3 (dynein, light chain, Tctex-type 3)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Dlc90F
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
dylt-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus laevis (African clawed frog):
dynlt3.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
DYNLT3P1
DYNLT3P2
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 37,838,836 - 37,847,571 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 37,836,757 - 37,847,571 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 37,698,089 - 37,706,824 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 37,583,033 - 37,591,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 37,454,305 - 37,463,048 NCBI Celera X 41,835,775 - 41,844,575 (-) NCBI Celera Cytogenetic Map X p11.4 NCBI HuRef X 35,443,356 - 35,452,111 (-) NCBI HuRef CHM1_1 X 37,729,229 - 37,738,029 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 37,242,419 - 37,251,154 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
DYNLT3 Human (+)-schisandrin B multiple interactions ISO RGD:1549755 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DYNLT3 mRNA] CTD PMID:31150632 DYNLT3 Human (-)-alpha-phellandrene increases expression EXP 6480464 alpha phellandrene results in increased expression of DYNLT3 mRNA CTD PMID:25075043 DYNLT3 Human 1,2-dimethylhydrazine decreases expression ISO RGD:1556957 6480464 1,2-Dimethylhydrazine results in decreased expression of DYNLT3 mRNA CTD PMID:22206623 DYNLT3 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1556957 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DYNLT3 mRNA CTD PMID:22206623 DYNLT3 Human 17beta-estradiol multiple interactions EXP 6480464 EGF protein promotes the reaction [Estradiol results in increased expression of DYNLT3 mRNA] CTD PMID:24758408 DYNLT3 Human 17beta-estradiol decreases expression ISO RGD:1556957 6480464 Estradiol results in decreased expression of DYNLT3 mRNA CTD PMID:39298647 DYNLT3 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DYNLT3 mRNA CTD PMID:24758408|PMID:31614463 DYNLT3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1549755 6480464 Tetrachlorodibenzodioxin results in decreased expression of DYNLT3 mRNA CTD PMID:21215274|PMID:33387578 DYNLT3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1556957 6480464 Tetrachlorodibenzodioxin results in increased expression of DYNLT3 mRNA CTD PMID:15034205 DYNLT3 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1556957 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of DYNLT3 mRNA] CTD PMID:15034205 DYNLT3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1556957 6480464 Tetrachlorodibenzodioxin affects the expression of DYNLT3 mRNA CTD PMID:21570461 DYNLT3 Human 2-hydroxypropanoic acid affects expression EXP 6480464 Lactic Acid affects the expression of DYNLT3 mRNA CTD PMID:30851411 DYNLT3 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 DYNLT3 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 DYNLT3 Human 4-hydroxynon-2-enal affects binding EXP 6480464 DYNLT3 protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 DYNLT3 Human aflatoxin B1 increases expression ISO RGD:1556957 6480464 Aflatoxin B1 results in increased expression of DYNLT3 mRNA CTD PMID:19770486 DYNLT3 Human aflatoxin B1 increases expression ISO RGD:1549755 6480464 Aflatoxin B1 results in increased expression of DYNLT3 mRNA CTD PMID:33354967 DYNLT3 Human alpha-phellandrene increases expression EXP 6480464 alpha phellandrene results in increased expression of DYNLT3 mRNA CTD PMID:25075043 DYNLT3 Human antimycin A decreases expression EXP 6480464 Antimycin A results in decreased expression of DYNLT3 mRNA CTD PMID:33512557 DYNLT3 Human Aroclor 1254 decreases expression ISO RGD:1556957 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of DYNLT3 mRNA CTD PMID:23650126 DYNLT3 Human benzo[a]pyrene multiple interactions ISO RGD:1556957 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of DYNLT3 mRNA] CTD PMID:15034205 DYNLT3 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of DYNLT3 3' UTR CTD PMID:27901495 DYNLT3 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of DYNLT3 promoter CTD PMID:27901495 DYNLT3 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of DYNLT3 exon CTD PMID:27901495 DYNLT3 Human benzo[a]pyrene increases expression ISO RGD:1556957 6480464 Benzo(a)pyrene results in increased expression of DYNLT3 mRNA CTD PMID:15034205|PMID:22228805 DYNLT3 Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of DYNLT3 mRNA CTD PMID:31163220 DYNLT3 Human bisphenol A increases expression ISO RGD:1549755 6480464 bisphenol A results in increased expression of DYNLT3 mRNA CTD PMID:25181051 DYNLT3 Human bisphenol A decreases expression ISO RGD:1556957 6480464 bisphenol A results in decreased expression of DYNLT3 mRNA CTD PMID:33221593 DYNLT3 Human bisphenol A decreases expression ISO RGD:1549755 6480464 bisphenol A results in decreased expression of DYNLT3 mRNA CTD PMID:34947998|PMID:38750585 DYNLT3 Human bisphenol A increases methylation ISO RGD:1549755 6480464 bisphenol A results in increased methylation of DYNLT3 gene CTD PMID:28505145 DYNLT3 Human buspirone decreases expression ISO RGD:1549755 6480464 Buspirone results in decreased expression of DYNLT3 mRNA CTD PMID:24136188 DYNLT3 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of DYNLT3 mRNA CTD PMID:26079696 DYNLT3 Human captan increases expression ISO RGD:1556957 6480464 Captan results in increased expression of DYNLT3 mRNA CTD PMID:31558096 DYNLT3 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of DYNLT3 mRNA CTD PMID:25979313 DYNLT3 Human carbon nanotube decreases expression ISO RGD:1556957 6480464 Nanotubes, Carbon results in decreased expression of DYNLT3 mRNA CTD PMID:25620056 DYNLT3 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to DYNLT3 gene] CTD PMID:28238834 DYNLT3 Human chlormequat chloride increases expression ISO RGD:1549755 6480464 Chlormequat results in increased expression of DYNLT3 protein CTD PMID:34958886 DYNLT3 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of DYNLT3 mRNA CTD PMID:27594783 DYNLT3 Human copper atom increases expression ISO RGD:1556957 6480464 Copper results in increased expression of DYNLT3 mRNA CTD PMID:16629173 DYNLT3 Human copper(0) increases expression ISO RGD:1556957 6480464 Copper results in increased expression of DYNLT3 mRNA CTD PMID:16629173 DYNLT3 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DYNLT3 mRNA CTD PMID:19167446 DYNLT3 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 DYNLT3 Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of DYNLT3 mRNA CTD PMID:28302478 DYNLT3 Human dioxygen multiple interactions ISO RGD:1556957 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of DYNLT3 mRNA CTD PMID:30529165 DYNLT3 Human disodium selenite increases expression EXP 6480464 Sodium Selenite results in increased expression of DYNLT3 mRNA CTD PMID:18175754 DYNLT3 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 DYNLT3 Human ethanol affects splicing ISO RGD:1556957 6480464 Ethanol affects the splicing of DYNLT3 mRNA CTD PMID:30319688 DYNLT3 Human folic acid decreases expression ISO RGD:1556957 6480464 Folic Acid results in decreased expression of DYNLT3 mRNA CTD PMID:25629700 DYNLT3 Human folic acid multiple interactions ISO RGD:1556957 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DYNLT3 mRNA CTD PMID:22206623 DYNLT3 Human folpet increases expression ISO RGD:1556957 6480464 folpet results in increased expression of DYNLT3 mRNA CTD PMID:31558096 DYNLT3 Human glafenine decreases expression ISO RGD:1549755 6480464 Glafenine results in decreased expression of DYNLT3 mRNA CTD PMID:24136188 DYNLT3 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 DYNLT3 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of DYNLT3 protein CTD PMID:32959892 DYNLT3 Human kojic acid decreases expression EXP 6480464 kojic acid results in decreased expression of DYNLT3 mRNA CTD PMID:16595896 DYNLT3 Human lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with resveratrol] results in decreased expression of DYNLT3 mRNA CTD PMID:26667767 DYNLT3 Human miconazole decreases expression ISO RGD:1556957 6480464 Miconazole results in decreased expression of DYNLT3 mRNA CTD PMID:27462272 DYNLT3 Human monosodium L-glutamate multiple interactions ISO RGD:1556957 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of DYNLT3 mRNA CTD PMID:22078008 DYNLT3 Human nefazodone decreases expression ISO RGD:1549755 6480464 nefazodone results in decreased expression of DYNLT3 mRNA CTD PMID:24136188 DYNLT3 Human nimesulide decreases expression ISO RGD:1549755 6480464 nimesulide results in decreased expression of DYNLT3 mRNA CTD PMID:24136188 DYNLT3 Human paracetamol increases expression ISO RGD:1549755 6480464 Acetaminophen results in increased expression of DYNLT3 mRNA CTD PMID:33387578 DYNLT3 Human perfluorohexanesulfonic acid increases expression ISO RGD:1556957 6480464 perfluorohexanesulfonic acid results in increased expression of DYNLT3 mRNA CTD PMID:37995155 DYNLT3 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of DYNLT3 mRNA CTD PMID:26272509 DYNLT3 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 DYNLT3 Human pirinixic acid decreases expression ISO RGD:1556957 6480464 pirinixic acid results in decreased expression of DYNLT3 mRNA CTD PMID:18445702 DYNLT3 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of DYNLT3 mRNA CTD PMID:22714537 DYNLT3 Human propiconazole decreases expression ISO RGD:1556957 6480464 propiconazole results in decreased expression of DYNLT3 mRNA CTD PMID:21278054 DYNLT3 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of DYNLT3 mRNA CTD PMID:21632981 DYNLT3 Human rac-lactic acid affects expression EXP 6480464 Lactic Acid affects the expression of DYNLT3 mRNA CTD PMID:30851411 DYNLT3 Human resveratrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DYNLT3 mRNA; [Lipopolysaccharides co-treated with resveratrol] more ... CTD PMID:19167446|PMID:26667767 DYNLT3 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of DYNLT3 mRNA CTD PMID:33512557 DYNLT3 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 DYNLT3 Human silicon dioxide increases methylation EXP 6480464 Silicon Dioxide results in increased methylation of DYNLT3 gene CTD PMID:34973136 DYNLT3 Human sodium arsenate increases expression ISO RGD:1556957 6480464 sodium arsenate results in increased expression of DYNLT3 mRNA CTD PMID:21795629 DYNLT3 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DYNLT3 mRNA CTD PMID:38568856 DYNLT3 Human sulforaphane multiple interactions ISO RGD:1556957 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of DYNLT3 mRNA CTD PMID:30529165 DYNLT3 Human testosterone decreases expression ISO RGD:1556957 6480464 Testosterone results in decreased expression of DYNLT3 mRNA CTD PMID:21669218 DYNLT3 Human tetrachloromethane affects expression ISO RGD:1556957 6480464 Carbon Tetrachloride affects the expression of DYNLT3 mRNA CTD PMID:17484886 DYNLT3 Human tetrachloromethane multiple interactions ISO RGD:1549755 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DYNLT3 mRNA] CTD PMID:31150632 DYNLT3 Human tetrachloromethane decreases expression ISO RGD:1549755 6480464 Carbon Tetrachloride results in decreased expression of DYNLT3 mRNA CTD PMID:31150632 DYNLT3 Human tolcapone decreases expression ISO RGD:1549755 6480464 tolcapone results in decreased expression of DYNLT3 mRNA CTD PMID:24136188 DYNLT3 Human trichostatin A affects expression EXP 6480464 trichostatin A affects the expression of DYNLT3 mRNA CTD PMID:28542535 DYNLT3 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of DYNLT3 mRNA CTD PMID:37042841 DYNLT3 Human vinclozolin increases expression ISO RGD:1549755 6480464 vinclozolin results in increased expression of DYNLT3 mRNA CTD PMID:23869203
DYNLT3 Human Autism IAGP RGD:14351525 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:21681106|PMID:30208311
DYNLT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 37,838,836 - 37,847,571 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 37,836,757 - 37,847,571 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 37,698,089 - 37,706,824 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 37,583,033 - 37,591,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 37,454,305 - 37,463,048 NCBI Celera X 41,835,775 - 41,844,575 (-) NCBI Celera Cytogenetic Map X p11.4 NCBI HuRef X 35,443,356 - 35,452,111 (-) NCBI HuRef CHM1_1 X 37,729,229 - 37,738,029 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 37,242,419 - 37,251,154 (-) NCBI T2T-CHM13v2.0
Dynlt3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 9,520,509 - 9,529,222 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 9,520,506 - 9,529,242 (-) Ensembl GRCm39 Ensembl GRCm38 X 9,654,270 - 9,662,983 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 9,654,267 - 9,663,003 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 9,231,396 - 9,240,109 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 8,811,229 - 8,819,942 (-) NCBI MGSCv36 mm8 Celera X 7,370,355 - 7,379,067 (-) NCBI Celera Cytogenetic Map X A1.1 NCBI cM Map X 4.47 NCBI
Dynlt3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 16,000,425 - 16,009,632 (+) NCBI GRCr8 mRatBN7.2 X 13,327,933 - 13,337,139 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 13,327,892 - 13,337,139 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 13,515,051 - 13,524,263 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 17,011,983 - 17,021,195 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 13,268,568 - 13,277,780 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 14,633,342 - 14,642,356 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 14,633,342 - 14,642,424 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 15,414,610 - 15,423,884 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 25,480,916 - 25,490,479 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 14,088,617 - 14,097,885 (-) NCBI Celera Cytogenetic Map X q12 NCBI
Dynlt3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955587 827,278 - 838,869 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955587 828,730 - 838,614 (-) NCBI ChiLan1.0 ChiLan1.0
DYNLT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 39,487,750 - 39,496,644 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 39,491,124 - 39,499,945 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 30,289,242 - 30,298,033 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 37,998,059 - 38,006,855 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 37,996,729 - 38,006,855 (-) Ensembl panpan1.1 panPan2
DYNLT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 32,603,881 - 32,611,213 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 32,603,945 - 32,611,542 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 19,951,574 - 19,958,842 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 32,648,884 - 32,656,216 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 32,648,888 - 32,656,545 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 32,730,392 - 32,737,658 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 32,694,273 - 32,701,541 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 32,742,263 - 32,749,531 (-) NCBI UU_Cfam_GSD_1.0
Dynlt3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 24,850,099 - 24,860,957 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 4,690,776 - 4,701,750 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 4,690,810 - 4,701,615 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DYNLT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 33,711,492 - 33,724,683 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 33,711,993 - 33,724,596 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 37,424,941 - 37,437,546 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DYNLT3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666056 38,299,966 - 38,308,644 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dynlt3
.
Predicted Target Of
Count of predictions: 1415 Count of miRNA genes: 832 Interacting mature miRNAs: 965 Transcripts: ENST00000378578, ENST00000378581, ENST00000432389 Prediction methods: Miranda, Pita, Rnahybrid Result types: miRGate_prediction
597050100 GWAS1146174_H uterine fibroid QTL GWAS1146174 (human) 0.000007 uterine fibroid X 37841575 37841576 Human
DXS7492
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 37,698,130 - 37,698,473 UniSTS GRCh37 Build 36 X 37,583,074 - 37,583,417 RGD NCBI36 Celera X 41,835,816 - 41,836,159 RGD Cytogenetic Map X p21 UniSTS HuRef X 35,443,397 - 35,443,740 UniSTS Whitehead-YAC Contig Map X UniSTS
RH77891
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 128,957,583 - 128,957,765 UniSTS GRCh37 GRCh37 X 37,699,835 - 37,701,069 UniSTS GRCh37 Build 36 2 128,674,053 - 128,674,235 RGD NCBI36 Celera X 41,837,521 - 41,838,755 UniSTS Celera 2 122,264,220 - 122,264,402 RGD Cytogenetic Map X p21 UniSTS HuRef 2 121,263,861 - 121,264,043 UniSTS HuRef X 35,445,102 - 35,446,334 UniSTS
RH17973
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 37,698,205 - 37,698,406 UniSTS GRCh37 Build 36 X 37,583,149 - 37,583,350 RGD NCBI36 Celera X 41,835,891 - 41,836,092 RGD Cytogenetic Map X p21 UniSTS HuRef X 35,443,472 - 35,443,673 UniSTS
GDB:342122
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 37,700,999 - 37,701,188 UniSTS GRCh37 Build 36 X 37,585,943 - 37,586,132 RGD NCBI36 Celera X 41,838,685 - 41,838,874 RGD Cytogenetic Map X p21 UniSTS HuRef X 35,446,264 - 35,446,453 UniSTS
DXS1110
Human Assembly Chr Position (strand) Source JBrowse GRCh37 X 37,699,886 - 37,700,151 UniSTS GRCh37 Build 36 X 37,584,830 - 37,585,095 RGD NCBI36 Celera X 41,837,572 - 41,837,837 RGD Cytogenetic Map X p21 UniSTS HuRef X 35,445,153 - 35,445,416 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4971
1726
2350
6
624
1949
465
2268
7304
6470
53
3733
1
852
1743
1616
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000378578 ⟹ ENSP00000367841
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 37,838,836 - 37,847,571 (-) Ensembl
Ensembl Acc Id:
ENST00000378581 ⟹ ENSP00000367844
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 37,836,757 - 37,847,514 (-) Ensembl
Ensembl Acc Id:
ENST00000432389 ⟹ ENSP00000402695
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl X 37,840,543 - 37,847,408 (-) Ensembl
RefSeq Acc Id:
NM_006520 ⟹ NP_006511
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 X 37,838,836 - 37,847,571 (-) NCBI GRCh37 X 37,698,089 - 37,706,889 (-) ENTREZGENE Build 36 X 37,583,033 - 37,591,775 (-) NCBI Archive HuRef X 35,443,356 - 35,452,111 (-) ENTREZGENE CHM1_1 X 37,729,229 - 37,738,029 (-) NCBI T2T-CHM13v2.0 X 37,242,419 - 37,251,154 (-) NCBI
Sequence:
AGTGCGCGGCCGCGGTGCTCTACCGGCGTGTCGCTCCGCCCCAGGGAGAGCCGGCGCTACCATGGAGGAGTACCATCGCCACTGCGACGAGGTTGGCTTCAATGCTGAGGAAGCCCACAATATTGTCA
hide sequence
RefSeq Acc Id:
NP_006511 ⟸ NM_006520
- UniProtKB:
Q6ICS3 (UniProtKB/Swiss-Prot), P51808 (UniProtKB/Swiss-Prot), F2Z328 (UniProtKB/TrEMBL)
- Sequence:
MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL
hide sequence
Ensembl Acc Id:
ENSP00000367841 ⟸ ENST00000378578
Ensembl Acc Id:
ENSP00000367844 ⟸ ENST00000378581
Ensembl Acc Id:
ENSP00000402695 ⟸ ENST00000432389
RGD ID: 6808644 Promoter ID: HG_KWN:66413 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: ENST00000378574, ENST00000378581, OTTHUMT00000080876 Position: Human Assembly Chr Position (strand) Source Build 36 X 37,591,574 - 37,592,074 (-) MPROMDB
RGD ID: 6853278 Promoter ID: EP74460 Type: initiation region Name: HS_TCTE1L Description: T-complex-associated-testis-expressed 1-like. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 X 37,591,768 - 37,591,828 EPD
RGD ID: 13605028 Promoter ID: EPDNEW_H28698 Type: initiation region Name: DYNLT3_1 Description: dynein light chain Tctex-type 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28699 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 X 37,847,571 - 37,847,631 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-07
DYNLT3
dynein light chain Tctex-type 3
dynein, light chain, Tctex-type 3
Symbol and/or name change
5135510 APPROVED
